CLUSTAL W (2.1) Multiple Sequence Alignments
HUM20049|MRPL12      -MLPAAARPLWGPCLGLRAAAFRLARRQVPCVCAVRHMRSSGHQRCEALAGAPLDNAPKEYPPKIQQLVQDIASLTLLEISDLNELLKKTLKIQDVGLVP
MUS20038|Mrpl12      MLPVAASRCLWGPRLGLRGAALRLARQQMPSVCAARQLRSSSHRRSEALAGAPLDNAPKEYPPKIQQLVQDIASLTLLEISDLNELLKKTLKIQDVGLMP
FUG20035|MRPL7-L12   --MYCTRYCLRTAMRAAANIQRQHLQQQGPSLCAVRHLKTGQGCHSDAIAAPPLDGAPKQYSPKIQQLVNDIASLTLLEVSDLNELLKKTLNIQDVGMVP
DAN20044|Mrpl12      -MMYCSRHCVRLALRAAVNTHRHSVQR--TALYAQRTLKTSSVSAVDAIATPHLDGTPKEYSPKIQQLVNDIASLTLIEVSDLNELLKKTLNIQDVGMMS
DRO20037|mRpL12      -------------MHITRLALRQISRQVQLHRMYSAAAPAAAVSGAEKLVPPAPEGAAKPPNPKLDSIVNNIAALNLLEVAELSTLLKQKLNLPETAFAP
CEL20034|MRPL-12     ---------------MLSRTLRPISKVLRSSAKYSQAAGLPLNEGSPAPLP----SEDRAISAKVSSLVEEIANLSLLDVSDLNWALKKRLNIPDQPLMA


HUM20049|MRPL12      MGGVMSG--AVPAAAAQEAVEEDIPIAKERTHFTVRLTEAKPVDKVKLIKEIKNYIQGINLVQAKKLVESLPQEIKANVAKAEAEKIKAALEAVGGTVVL
MUS20038|Mrpl12      MGGMVPGPVSAAAPASEAAEEEDVPKQKERTHFTVRLTEAKPVDKVKLIKEIKNYVQGINLVQAKKLVESLPQEIKANVAKAEAEKIKAALEAVGGTVVL
FUG20035|MRPL7-L12   MA----AAAPVAQVE---EEEDVVPVKKEKTHFTVKLTELKAADKVKLIKEVKNCIQGLNLVQAKKLVESLPQEIRANVSKDEAEKLKAALEAAGGTVVL
DAN20044|Mrpl12      MG----SMAAVPVAPPAEAEEEVAPAKKEKTHFTIKLTEFKAADKVKLIKEVKNCMEGINLVQAKKLVESLPQEIRTNISKDEAEKLKSALEAAGGTVVL
DRO20037|mRpL12      QF------AAGPARAAPAEDEEEAAPKKVQTSFKVKLVKFDEKQKVALIKEVKNLLEGMNLVQAKKFVESAPTIVKEDIPKEEAEKLKEALSKAGAIIEI
CEL20034|MRPL-12     AA------AAAPAAQAEAEAASDVP---QKMTFTVKLTKFDDTKKIAIIKEIRNAIPGLNLVQAKKFVETAPVNVKEDLGKAEADELKAILEKAGATIEI


HUM20049|MRPL12      E
MUS20038|Mrpl12      E
FUG20035|MRPL7-L12   E
DAN20044|Mrpl12      E
DRO20037|mRpL12      E
CEL20034|MRPL-12     V