CLUSTAL W (2.1) Multiple Sequence Alignments
HUM20056|MRPL19      ------------MGLGRSFQAARTLLPPPASIACRVHAGPVRQQSTGP--SEPGAFQPPPKP-VIVDKHRPVEPERRFLSPEFIP--RRGRTDPLKFQIE
MUS20045|Mrpl19      MAASMAESCRASLYLARSVRMARPRLAAFASDACRVCTGPSRFQSTGP--SEPGGFKPPPKP-VIVDRRRVPEDERRFLSPEFIP--PRGRTNPLKFKIE
FUG20046|MRPL19      --------MAACAKGLDKLRHSLRLLRNTQLHNERFLSTSKGRQSAGSNTEQPPKFVPPSKP-VIVDKTRAVASLRKFLSPEFIP--PRQRTDPLKFFIE
DAN20051|Mrpl19      --------MAACTRRAREMMGLLRFLRN-IPQTERFLSTSVMRHAS----DGPSKFIPPTKP-VFTDKSQEEASVRRVLSPEFIP--PRQRTDQIKFYIE
DRO20047|mRpL19      --------------MNLSTRVMLNRLTQQCVYKRIVTFSTKTAEHVIENQEEQKKEAPPTTPTSPVNRKTIIPANYRFVYPEFLPDPKVEWRNLVREKLE
CEL20044|MRPL-19     --------------------MFRPAAREVVKLPVRYFSCK----------SEPTRAAPVTKK-TSREEIAGLIPAFPEIYPDFLQSPVWNRRNALKEELE


HUM20056|MRPL19      RKDMLERRKVLHIPEFYVGSILRVTTADPYASGKISQFLGICIQRSGRGLGATFILRNVIEGQGVEICFELYNPRVQEIQVVKLEKRLDDSLLYLRDALP
MUS20045|Mrpl19      RKDMLDRRKVLPIPEFYVGSILRVTTADPYASGKTSQFLGICIKRSGNGLGATFTLRNTIEGQGVEICFELYNPRIQEIQVVKLEKRLDDNLLYLRDALP
FUG20046|MRPL19      RKDMIRRRKVLNIPEFYAGSILAVTMADKNASGKTNRFVGICIQRGGNGLGATFVLRNIIDNQGVEICYEMYNPRIQKIEVLKLEKRLDDNLMYLRDALP
DAN20051|Mrpl19      RKDMIQRRKVLQIPEFYVGSILAVTMTDPYASGNLNRFVGICTQRSGKGLGATFILRNVIDGQGVEICYELYSPRMRKIEVLKLEKRLDDNLMYLRDALP
DRO20047|mRpL19      RLDMLDRRKQIDLPEFYVGSVLAVTSSDPHAAGKTSRFVGICINRDRCGLRARFILRNVIDHQGMEVVYELYDPTILKIEVLRLEKRLDDSLFYLRDALP
CEL20044|MRPL-19     RQDMLERRMNIDIPEFYVGSIVAVTSSDKNLGSKEHRFVGICIRREKEGLLHQFTLRNTIENIGVEVVYDLYNPTIKKIETLKLEKRLDNDLSYLVDALP


HUM20056|MRPL19      EYSTFDVNMKPVVQEPNQKVPVNELKVKMKPKPWSKRWERPNFNIKGIRFDLCLTEQQMKEAQKWNQPWLEFDMMREYDTSKIEAA---IWKEIEASKRS
MUS20045|Mrpl19      EYSTFDVNMKPVPQEACQEVPVNKLKVKMKPKPWSKRWERPNFNIKGIRFDLALTEEQMKEAQKWNKPWIEFDMMREYDTSKIEAA---LWEEIEASKKS
FUG20046|MRPL19      EYSTVDPDMRPVPISDTDEVPVNKLKVRMRPKPWSKRWERPRFNIQGMRFDLALSPEQMEHAQKWAQPWLEYDMLKEYDTSKLEEQ---IYTEVQQEMSK
DAN20051|Mrpl19      EYSTFDFDMQPVHYELTKDIPVNPLKVKMKPKPWSKRWERPKFDIKGIRFDLYLTPEQMEHAQKWGEPWREYDMLKEYDTSSLEKK---ILEEVDENLRK
DRO20047|mRpL19      EYSTFDENMEAEPLEEGAPVPVNDIKVVLRPRPWLERWERQNLRGVAN-IDEYLKDKHRLSAAKVQKPWEKYDMMKDYRSSIPEEEQTEIFAEVHTELHA
CEL20044|MRPL-19     EYSTFDFHMEPQAHPAGTPIPVNECKVKLKTPPWTRRWEVASVRGIEDTWTQATPWFKRKLHKTIVNDYEKYDLIADYRTSSTKEQEVFVQKQMQKFEKE


HUM20056|MRPL19      ---------------------
MUS20045|Mrpl19      ---------------------
FUG20046|MRPL19      KPLAG----------------
DAN20051|Mrpl19      ---------------------
DRO20047|mRpL19      LELQRKRNKRKRTFIKPKQLA
CEL20044|MRPL-19     RHAAGLTRRRILKSAAAYK--