CLUSTAL W (2.1) Multiple Sequence Alignments
HUM20082|MRPL39-1    MEALAMGSRALRLWLVAPGGGIKWRFIATSSASQLSPTELTEMRNDLFNKEKARQLSLTPRTEKIEVKHVGKTDPGTVFVMNKNISTPYSCAMHLSEWYC
HUM20083|MRPL39-2    MEALAMGSRALRLWLVAPGGGIKWRFIATSSASQLSPTELTEMRNDLFNKEKARQLSLTPRTEKIEVKHVGKTDPGTVFVMNKNISTPYSCAMHLSEWYC
MUS20061|Mrpl39      ---MATAVGRLVLRRPGAGGGARWRFIATSPAAELSPTELTEMRNDLFNREKSRQLSLTPRTEKIEVKHVGKTDPGTVFVMNKNISTPYSCAMHLSEWYC
FUG20062|MRPL39      -----------MVTRKVCQFLQRRCAS-AAAAVRPPPAEMLSQRNAVFSREQARQRALYPRIEKIEVSMHGPGLDGTLLIMNKGMSTPLSCARHLTEYHV
DAN20067|Mrpl39      ----------MATARTVGQMLQRRMVSSAAAAPRLSSAAVLAQRSAQFSREQLRQRALQPRVEKVEVQLQGPGLQGTLLVMNRGLSTPYSCARHLSEWHV
DRO20063|mRpL39      -------MSAATKLHKTSWCALRQLQQYRTKANFSGSSASLAKRNDLFNQEQRRQRDAVGRIDKIEVRYLG-LPEDVTLVMNGNISTPFNCAQHLSEGHC


HUM20082|MRPL39-1    RKSILALVDG-QPWDMYKPLTKSCEIKFLTFKDCDPGEVNKAYWRSCAMMMGCVIERAFKDEYMVNLVRAPEVPVISGAFCYDVVLDSKLDEWMPTKENL
HUM20083|MRPL39-2    RKSILALVDG-QPWDMYKPLTKSCEIKFLTFKDCDPGEVNKAYWRSCAMMMGCVIERAFKDEYMVNLVRAPEVPVISGAFCYDVVLDSKLDEWMPTKENL
MUS20061|Mrpl39      SKSILALVDG-QPWDMYKPLTKSCEIKFLTFKDPDPKEVNKAYWRSCAMMLGCVIERAFKDDYVVSLVRAPEVPVIAGAFCYDVTLDKRLDEWMPTKENL
FUG20062|MRPL39      NNSVLALVDG-ELWPLHRPLTHSCSLSLLTFKDNDPTVVNEAYWRSCAALLGQVLETAFKDKFNVDLLSTVEVPVTSGAFCCDVVLDPQLDSWTPSEESL
DAN20067|Mrpl39      NSSALALVDG-QPWHMHKPLTRSCELTLLTFRDADPQTLNQAYWRSCAALLGLVLESAFKDQFSVELLKTPEVPVTAGAFCCDLLLDPLLDSWKPTEENL
DRO20063|mRpL39      KRSALALIDGSVPWDMHRPLQESCTLQLLNFHVSEPHVVNKAFWRTCSFMLGAALNRAFKPEANLQLHSFPGPNIKSGSFVHDIVLQTQN--WEPGKEEM


HUM20082|MRPL39-1    RSFTKDAHALIYKDLPFETLEVEAKVALEIFQHSKYKVDFIEEKASQNPERIVKLHRIGDFIDVSEGPLIPRTSICFQYEVSAVHNLQP-TQPSLIRRFQ
HUM20083|MRPL39-2    RSFTKDAHALIYKDLPFETLEVEAKVALEIFQHSKYKVDFIEEKASQNPERIVKLHRIGDFIDVSEGPLIPRTSICFQYEVSAVHNLQP-TQPSLIRRFQ
MUS20061|Mrpl39      RSFTKDAHALIYRDLPFETLDVDARVALEIFQHNKYKVDFIEEKASQNPERIVKLHRIGDFIDVSEGPLIPRTSVCFQYEVSAVHNLNP-SQPNLIRRFQ
FUG20062|MRPL39      RSLTKGAQQLILKDLAWEPLEVVPSVALEVFSHHRCKQEEIEQKAAENPKGTVMLYRCGDHVLLSGGPLVARTGLCLQYEVTALHSLGQ-GPWGLHRRAQ
DAN20067|Mrpl39      RSLTRDALQMISRDLPWEPLEVSASLALEIFSQSRCKQEEVEEAAAQSQNGTVTLYRCGDHVTLSSAPLVSRTGLCSQFEVTSIHTLSE-HTRGVQRRAQ
DRO20063|mRpL39      RALSAEMVKLAAQDLRIERLDVQQDLAQEMFKDSKYKSEQLPSISQQTN-GRVTLYRLGDHIDISRGPMVASTSFLGKCVISAAHKVAEEGPSGAFYRIQ


HUM20082|MRPL39-1    GVSLPVHLRAHFTIWDKLLERSRKMVTEDQSKATEECTST----------------
HUM20083|MRPL39-2    GVSLPVHLRAHFTIWDKLLERSRKMTPFPILLLFTTQSFFTTSPESYLLHGTVSE-
MUS20061|Mrpl39      GLSLPTHLRAQFTIWDKLVERSRKMVTEDEVRQTENTESTQ---------------
FUG20062|MRPL39      GLSLPLQLQAHHTVWRKLRQRAEKLVRATDTHTLPAHTLARQQQHQSCGAEAKLAE
DAN20067|Mrpl39      GLSLPVNLTAHHTVWRKLRKRAERLVELPSSSTEAPPFNTETPPAASVTPPPLP--
DRO20063|mRpL39      GVALPSGFQLNHVAFGVLEERSKKPSPARLPNEPFEEQQQLQLS------------