CLUSTAL W (2.1) Multiple Sequence Alignments
HUM20086|MRPL42-1    ---MAVAAVKWVMSKRTILKHLFPVQNGALYCVCHKSTYSPLPDDYNCNVELALTSDGRTIVCYHPSVDIPYEHTKPIPRPDPVHNNEETHDQVLKTRLE
HUM20087|MRPL42-2    ---MGDVKENYLETFISSPKFGRTCADGALYCVCHKSTYSPLPDDYNCNVELALTSDGRTIVCYHPSVDIPYEHTKPIPRPDPVHNNEETHDQVLKTRLE
HUM20088|MRPL42-3    ---MAVAAVKWVMSKRTILKHLFPVQNGALYCVCHKSTYSPLPDDYNCNVELALTSDGRTIVCYHPSVDIPYEHTKPIPRPDPVHNNEETHDQVLKTRLE
MUS20064|Mrpl42      ----MAAAVKWAISNRTIWKHLLPIQNGALSSACHKSTYSSLPDDYNCQVDLALTADGRTIVCYHPSVDIPYEHTKPIPQPDLLHNNEETHEQILKAKLE
FUG20065|MRPL42      MASGRLCILSRVLTRLTNVTALHSAQTCLVPLRQQSSTRSPSMDDPHCNVEIGVTSDGSTVVCYHPATDIPYEFTQPIERPDPLTNPPESHDQVLKAHLS
DAN20070|Mrpl42      MASGHISRLANLFTSVNPSKHLKPFRGLFLSSVSKSTVGGSSIHD-DSNVEIAVTSDGNTIVCFHPADDVPYELTQPIVRPDAISGHAETHEQVLKDRLG
DRO20028|mRpL42      --------------------MSAARLYGGFRLFSSSAVQRNAVGGKSLVEAVAVTKNGRTIVAWHPDTPVPYENTLPLPEISEIQSSAVVKESALKTAMR
CEL20062|LPL-1       -----------------------MLRNLFSITYRFASSDSP--------RKVVVCANG-TIAAWHPPQHFPYEHTKPIDLGSLTKKDQSSRLSAAAKASS


HUM20086|MRPL42-1    EK-VEHLEEGPMIEQLSKMFFTTKHRWYPHGRYHRCRKNLNPPKDR-
HUM20087|MRPL42-2    EK-VEHLEEGPMIEQLSKMFFTTKHRWYPHGRYHRCRKNLNPPKDR-
HUM20088|MRPL42-3    EK-VEHLEEGPMIEQLSKMFFTTKHRWYPHGRYHRCRKNLNPPKDR-
MUS20064|Mrpl42      VRKSKQLEQGPMIEQLSKVFYTTKHRWYPHGQYHNRRKKLNPPRDR-
FUG20065|MRPL42      KE-VLSSNKGPSIEELSKMFFTTKHRWYPVGQ---------------
DAN20070|Mrpl42      KA-VLADKKAPTIEELSKMFYTTKHRWYPVGQFHNRRRKLNPPKDR-
DRO20028|mRpL42      AF--KSKHPEVARQELMQLTHTTKHRWFPRARDRKAKQTPMDRPYL-
CEL20062|LPL-1       IP------REPVNAELKDIFYTSKHEWYSRTREERLRNVAAPIPRRK