CLUSTAL W (2.1) Multiple Sequence Alignments
HUM20043|MRPL9       MAAPVVTAPGRALLRAGAGRLLRGGVQELLRPRHEGNAPDLACNFSLSQNRGTVIVERWWKVPLAGEG--RKPRLH-RRHRVYKLVEDTKHRPKENLELI
MUS20035|Mrpl9       -MAASVAPGVRTLWWAGAAWLRQGGIRELFRPRIEG--STPGRDFSLSHYQSTVIVERWWKVPLAGEG--RKPHLH-RRHRVYKLVEDTKHRPKDNLELI
FUG20036|MRPL9       ---------------MWSCSRR--------VLQELLSQPAAVRSFSLSSPQSTVVVERWWNVPLSKVG--SPPRLHPRRHRIYKLVEDTKHSPTPKMELI
DAN20040|Mrpl9       ---------------MWAATTSRFVLQNCWNFTNLRSSLSRVQNLSRTACKNTVIVERCWKVPLSKEG--KPPRLHPRRHKVYRLVEDKKNSPQDKMELI
DRO20038|mRpL9       ---------------------------MLKNIYVTPLNLLKSATSLQQQVRTTFVLKRKYDPPLHKTN--EKPRRMRAKNFIYELVDDTLVKKRPNIEVV
CEL20035|MRPL-9      -------------------------------MLSASQLHRFVQHINRQASRNTWVLRRVFQPEVTPPGGVQKNPNDFHDYQKYEVVEFETQKSAGPINVI


HUM20043|MRPL9       LTQSVENVGVRGDLVSVKKSLGRNRLLPQGLAVYASPENKKLFEEEKLLRQEGK-LEKIQTKAGEATVKFLKSCRLEVGMKNNVKWELNPEIVARHFFKN
MUS20035|Mrpl9       LTQSVDEIGVRGDLVSVKKSVGRNKLLSQGLAVYASPENRKLFEEEKSLRREGK-LEKIQTKAGEATVKFLRSCHLEVGMKNNVKWELNPEIVARHFFKN
FUG20036|MRPL9       LSQTVPKLGGRGDTVFVKKSVGRNKLLPQGLAVYPSPENKKIFAEELRLLREGKPEERVQTRTGQLTLEYFKRCKLRIIKMPPDDFEVNKEVLCRQFLKR
DAN20040|Mrpl9       LTQTVPKLGGRGDTVFVKKAVGRNKLLPEGLAVYPSQDNKDMFAEELKKLHEGDPEDRIQTRTGQQTVEFLKNTELKVPFHTSIQYSLTKEIVCRQFLRK
DRO20038|mRpL9       LKTFVEGVGDKGDVVSMKPHFVYNKLLLPGLAAYNTPEN----VAKYAKTEAEKSTVKHSSPYAQRTVNMLETIVLAVVMNKDEPWVLEPWHIK-ASLRK
CEL20035|MRPL-9      LLQDVEGIGHQFDVVSVDRTLARKDLLLSKKAVYASPFDLKYYSDMKTRMAEELASRIRIPYELKVVGRDLQKMVIPIKVNMENQWTIDRNLVK-SSLRQ


HUM20043|MRPL9       LGVVVAPHTLKLPEEPITRW------GEYWCEVTVNGLDTVRVPMSVVNFEKPKTKRYKY---------WLAQQAAKAMAPTSPQI--------------
MUS20035|Mrpl9       LGVVVAPHALRLPEEPITRW------GEYWCDVTVNGLDTVRVPMSVVLFQKPKTKRYKH---------WLAQQAAKSVAPTNPQAV-------------
FUG20036|MRPL9       -GVVVPPHALDFPFESVKEE------GEYWCDISVNGIDTVRVPVSLEPYKDVSAKYQKQ---------L------------------------------
DAN20040|Mrpl9       RGVVVPPHALTLPEEPITGP------GEHWCEVTVNGLDRVRVPMSVVPFVEPRQLLLMK---------QQQSLKESDSE--------------------
DRO20038|mRpL9       TGFYCREECITLPKERIEGPDLKKENKDFYCTVTINKLEQARLKCRLHHWSTDPSERLPY---------VLEHWKLQSEPLLDVCSPEKTP---------
CEL20035|MRPL-9      MGVFVAENTIFLAAKPISGPNFDIEAKLFRFYVVVNQQYIVPMLGRITHISVDESKQMISPTLTTPRDEELARYSIRKEFPLYSKNNDFTEDFPIFEHMK


HUM20043|MRPL9       --------
MUS20035|Mrpl9       --------
FUG20036|MRPL9       --------
DAN20040|Mrpl9       --------
DRO20038|mRpL9       --------
CEL20035|MRPL-9      EHAPTTPH