CLUSTAL W (2.1) Multiple Sequence Alignments
HUM20013|MRPS15      ----------------MLRVAWRTLSLIRTRAVTQVLVPGLPGGGSAKFPFNQWGLQPRSLLLQAARGYVVRKPAQSRL------DDDPPPSTLLKDYQN
MUS20010|Mrps15      ----------------MLRAAWRALSSVRAQAVTRAPVPALRGGSSASLLSARCGLQPPSLLRAARAYAAVQKPVQPKQ------DDEPPSSAFIKEYKD
FUG20010|MRPS15      -----------MFQNVAIRAFVKCSTGILRESCSVSPVLAAKSWSCSS-----ALLGPGVVALPTPVRHYARAVKKKRTGMPFLRASSVIFLQQCSSWIT
DAN20013|Mrps15      ------MVLKSVFRSTVLGLRTWSVFSVARQSKTTLPAFSQAQCSSYTNWTFSRHFKGDETLLNQPVRQYARPSRKKQE---FPSQLEDLKTSMLKHEYA
DRO20011|mRpS15/bons ----------------------------------MNKLLNIAQAGHRQFVREYAFKSDLKIKWMRPEKIACYKPEKSGD----LAKLPPLKADELLPEYR
CEL20010|MRPS-15     MINLRRFVHTSCRLERGRTAFYNVHQKVTDPAKQDPDYFEKKARELPLDQNYIDALTKLYYEKIGSERDLGLKAADNLILEKTEFGLPRIEKSKTRAKYE


HUM20013|MRPS15      VPG-IEKVDDVVKRLLSLEMANKKEMLKIKQEQFMKKIVANPEDTRSLEARIIALSVKIRSYEEHLEKHRKDKAHK-----RYLLMSIDQRKKMLKNLRN
MUS20010|Mrps15      IIPNIEKVDDVVKRILSLEMASRKEKLKIKQEQLMNKIVENPEDSRTLEAQIIALTVRIRNYEEHMQKHRKDKAHK-----RHLLMSIDRRKKLLKILRQ
FUG20010|MRPS15      QLCQWLKPDDIIKRLLSLELASHREKLQLKTEQLISKVQRDENDRSSMEVQVATLTARIRNYQEHLQKNHKDKANK-----RRMLMAIDKRKKLLKKLRL
DAN20013|Mrps15      SVPLAQSVDDVVKKLLTLEFANHSEKLRLKEEQLIAKVQRDENDRSSTEVKVAILTARIRNFQEHLHKHPKDKANK-----RWMLMTIDKRKKLLKFLRR
DRO20011|mRpS15/bons DCKELDKADESVKSLFKLSNNASYLTTKFYRDEMVKEVQRHAQDFGSMEAKLAKMTAVIRRYQEHMDKHPRDKMIK-----VRLKELIDKRKKFLKYLRR
CEL20010|MRPS-15     DLDVLSNAPESVKKIFSVEMATRKELSQEWKQSLIKSVRQHSLDENSLEMKIAWLTALIRHWSLLVNDIGQETKKKPTWLTHRIWLVINERRKALRILRE


HUM20013|MRPS15      TNYDVFEKICWGLGIEYTFPPLYYRRAHRRFVTKKALCIRVFQETQ-KLKKRRRALKAAAAAQKQAKRR-NPDSPAKAIPKTLKDSQ-------------
MUS20010|Mrps15      TNYDVFEKTCKELGVEYTLPPLHFQKVHRRFLAKKALCIRVYQEVQ-KLKKQKRALKAAAAAAKKEKNEGVPENPSNAVPEKTQVN--------------
FUG20010|MRPS15      VRYSAFERVCEQLGITYTFPPEYYRRATRRWQAKKAFCIKVFKAVQ-KQKAEQRKKMKQHLASKNTETTLSQ----------------------------
DAN20013|Mrps15      TRYDSFEKVCKELGITYTFPPEYYRRVTRRWLAKKAFCNKVFKEVQ-RLKAAEREKQKAEEAERKKSSSSTNPQETAA----------------------
DRO20011|mRpS15/bons WDYPRFEWILEKLDLVYKPPPTHFHWITRKESLQKLTDIYCENLKEERLEAYHKQLQAQQIPFLEEAIKKMQFVRQEQISCDVPVTVTEEKIADSKRQLE
CEL20010|MRPS-15     RNETAFEKTIAALKISYHVPKQPAHVKTRKAWAEAQLKLRVENEKEKRLEELHEKYDKEVEEHKRETQEKRKALNNELDKLAQEMRQIDVIEGKSFETVG


HUM20013|MRPS15      ------------------------------
MUS20010|Mrps15      ------------------------------
FUG20010|MRPS15      ------------------------------
DAN20013|Mrps15      ------------------------------
DRO20011|mRpS15/bons MLKELQQAEAAASSKKQNEDGFN-------
CEL20010|MRPS-15     KYEPALISSLTETVIHSNLFYHPPPTMTEK