CLUSTAL W (2.1) Multiple Sequence Alignments
HUM20024|MRPS25      -MPMKGRFPIRRTLQYLSQGNVVFKDSVKVMTVNYNTHG-ELGEGARKFVFFNIPQIQYKNPWVQIMMFKNMTPSPFLRFYLDSGEQVLVDVETKSNKEI
MUS20020|Mrps25      -MPMKGRFPIRRTLQYLGRGDVVFKESVKIMTVNYNTYG-ELGEGARKFVFFNIPQIQYKNPWVQIMMFKNMTPSPFLRFYLDSGEQVLVDVETKSNKEI
FUG20020|MRPS25      -MPMKGRYPIRRTLEYLQKGDIIFKTKVKVLTVNYNTHG-ALGDGARKFVFFNIPQIQYKNPWVQIMMFKNMTPSPFLRFYLDDGERVLVDMEGKDHKQI
DAN20023|Mrps25      -MPMKGRFPIRRTLEYLQKGEVVFKKSVRIMTVNYNTHG-DLSEGARSFVFFKIPQIQYRNPWVQIMMFKNMTPSPFLRFYLDDGEQVLVDVEGKHYKEI
DRO20021|mRpS25      MPFMKGREPIRRTLKYLNAGKLVLKDKVRIFSVNYNTYG-AHHAGARDFVFWNIPQIQFKNPEVQVLTLKNMTPSPFVRCYFDDGRDMLIDLDSRNRNDI
CEL20019|MRPS-25     MPFMHGSMPLRRTFFYLQQGKVKLRDNVNVFSMGFHKNPTPEQSGARDFVYWNWAQLQYHNPKVQLVKHADKVVTPFARAYLNDGREVLFDLDGMKREEI


HUM20024|MRPS25      MEHIRKILGKNEETLREEEEEKKQLSHPANFGPRKYCLRECICEVEGQVPCPSLVPLPKEMRGKYKAALKADAQD
MUS20020|Mrps25      MEHIKKILGKKEETLREEELEKQQRFHPGNFGPRKYCLRECMCEVEGQVPCPGLVPLPKEMTGKYKAALKAST--
FUG20020|MRPS25      SEHVKKILGKSEEVLQTEALAKMLASNPANFGPKKYFPRECICEVDGQVPCPSTTPLPREMTGKYRAQMAASQE-
DAN20023|Mrps25      TEHVKKILGKTDEVLQAEAAAKMELFNPANFGPKKYFLRECMSEVEGQVPHPGRVPLPKEMTGKYKAKMAATADE
DRO20021|mRpS25      IDHLVKVVGKTREQLDAEERLKESKDNPANFG--YGCGRHCICEIPGQVPCPGTVPLPDHMRGKILFAPK-----
CEL20019|MRPS-25     EKLLAKTLGKTELVERREHLESIAKLNPADFG--SKNERQCMCEVQGQHPCTGLLRAPQCVTGKYRWNHNLI---