CLUSTAL W (2.1) Multiple Sequence Alignments
HUM20025|MRPS26      -----------------MLRALSRLGAGTPCRPRAPLVLPARGRKTRHDPLAKSKIERVNMPPAVDPAEFFVLMERYQHYRQTVRALRMEFVSEVQRKVH
MUS20021|Mrps26      -----------------MLRALNRLAARPETRPPTPLLLPVRGRKTRHDPPAKSKVGRVQTPPAVDPAEFFVLTERYRQYRETVRALRLEFTLEVRRKLH
FUG20021|MRPS26      --------------MFKLIVGRSVPAARLLAPRSGVLVEPVRGRKSRTDPVAKSKEDRIKVPPPVDPVEMVVLRERFSEYQLIMGALRLEFKEEMLRKKY
DAN20024|Mrps26      --------------MLRALSRCPLPAVRLLAPRSAVLVESVRGRKSRTDPQAKSKIGRIKTPPPVDPVEMITMKERYTEYNLILKALRLEFRENMLRKRY
DRO20022|mRpS26      -----------MLRAGCQLLTQSTLPTGKTVGNSFALEFVRWRRKPRWLPVAKSKMFRVPERKKQSEEERTELMRLHNQYKTQLRSVRQFLREEVVRHEE
CEL20020|MRPS-26     MLINSSRLSISSTGRCLLASAMSQMDEVFGVQKRQMGRRQPKQGKPPILPPSKKVLYHVVHAPWQKPEDVEELLWRRHAYNNAVISLREVFRAELAQNAS


HUM20025|MRPS26      EARAGVLAERKALKDAAEHRELMAWNQAENRRLHELRIARLRQEEREQEQRQALEQARKAEEVQAWAQRKEREVLQLQEEVKNFITRENLEARVEAALDS
MUS20021|Mrps26      EARAGVLAERKAQQAITEHRELMAWNRDENRRMQELRIARLQLEAQAQEVQKAEAQAQRAQEEQAWVQLKEQEVLKLQEEAKNFITRENLEARIEEALDS
FUG20021|MRPS26      EEETGCLAEERTRQEAEEHRSLMDWNHQENVRLLKLRIQRIQKEKEEMERKQAEAAISREQQQQEFIKAKEMEILQLQEESKNFITLENLDQRIEEALDN
DAN20024|Mrps26      EEEVGSVAEERAKRDAEEHKSLMAWNDAENHRLQVIREQRVQKEAEAAEEKRKEAAMLHQQELENYIKEKERQILQLQEEAKNFITLDNLDQRIEEALDN
DRO20022|mRpS26      TSTADHIVLTPEQEEAEFQKCLDAN-AAWNAAIAKERDQRLAKKREEKVAYIQERLEAQQLREEERKEQANQRVLLEIERSKNYITRENLDAAIETALAN
CEL20020|MRPS-26     HGQG---IEAMKEAEALELDELIAQNEKRNEEKRAARKEREAEDAKETKSVILEEIRVELEKRNAGKKQAEDEVKNAISRSSEFITRSNLETKILEALEK


HUM20025|MRPS26      RKNYNWAITREGLVVRPQRRDS------------------------------------
MUS20021|Mrps26      PKSYNWAVTKEGQVVRN-----------------------------------------
FUG20021|MRPS26      PKNYNFAVDKEGRVVKQTVLQ-------------------------------------
DAN20024|Mrps26      PINYNFAIDKQGRVVKRTAFQ-------------------------------------
DRO20022|mRpS26      PVDHNFAIDMAGNLYHGRSTSQLPDATPEPNQQVLSN---------------------
CEL20020|MRPS-26     PTIYDFAIDRAGNKYFVPEPVKYQEGTPTRQKGRLYDQTLGTQHGTIEEANKIQQKSV