CLUSTAL W (2.1) Multiple Sequence Alignments
HUM10042|RPL10       MGRRPARCYRYCKNKPYPKSRFCRGVPDAKIRIFDLGRKKAKVDEFPLCGHMVSDEYEQLSSEALEAARICANKYMVKSCGKDGFHIRVRLHPFHVIRIN
DOG10041|Rpl10       MGRRPARCYRYCKNKPYPKSRFCRGVPDAKIRIFDLGRKKAKVDEFPLCGHMVSDEYEQLSSEALEAARICANKYMVKSCGKDGFHIRVRLHPFHVIRIN
MUS10041|Rpl10       MGRRPARCYRYCKNKPYPKSRFCRGVPDAKIRIFDLGRKKAKVDEFPLCGHMVSDEYEQLSSEALEAARICANKYMVKSCGKDGFHIRVRLHPFHVIRIN
RAT10041|Rpl10       MGRRPARCYRYCKNKPYPKSRFCRGVPDAKIRIFDLGRKKAKVDEFPLCGHMVSDEYEQLSSEALEAARICANKYMVKSCGKDGFHIRVRLHPFHVIRIN
FUG10042|RPL10       MGRRPARCYRYCKNKPYPKSRFCRGVPDPKIRIFDLGRKKAKVDEFPLCGHMVSDEYEQLSSEALEAARICANKYMVKTCGKDGFHIRMRLHPFHVIRIN
DAN10041|Rpl10       MGRRPARCYRYCKNKPYPKSRFCRGVPDPKIRIFDLGRKKAKVDEFPLCAHMVSDEYEQLSSEALEAARICANKYMVKTCGKDGFHIRVRLHPFHVIRIN
CIO10041|RPL10       MGRRPARCYRYCKNKPYPKSRFCRGVPDPKIRIFDLGRKRADVRDFPLCMHMVSDELEQLSSEALEAARICANKYMVKYCGKDSFHLRVRVHPFHVVRIN
DRO10056|Qm          MGRRPARCYRYCKNKPYPKSRFCRGVPDPKIRIFDLGRKKATVEDFPLCVHLVSDEYEQLSSEALEAGRICCNKYLVKYCGKDQFHIRMRLHPFHVIRIN
MOS10041|Rpl10-1     MGRRPARCYRYCKNKPYPKSRFCRGVPDPKIRIFDLGRKKACVEDFPLCVHLVSDEYEQLSSEALEAGRICCNKYLVKFCGKDQFHIRMRLHPFHVIRIN
MOS10042|Rpl10-2     MGRRPARCYRYCKNKPYPKSRFCRGVPDPKIRIFDLGRKKACVEDFPLCVHLVSDEYEQLSSEALEAGRICCNKYLVKFCGKDQFHIRMRLHPFHVIRIN
BEE10043|Rpl10       MGRRPARCYRYCKNKPYPKSRFCRGVPDPKIRIFDLGKKKASVEDFPLCVHLVSDEYEQLSSEALEAGRICANKYMVKNAGKDQFHIRMRLHPFHVIRIN
CEL10043|rpl-10      MGRRPARCYRYIKNKPYPKSRFCRGVPDAKIRIFDLGNKRANVDTFPACVHMMSNEREHLSSEALEAARICANKYMVKNCGKDGFHLRVRKHPFHVTRIN
BMA10041|RPL10       MGRRPARCYRYIKNKPYPKSRFCRGVPDPKIRIFDLGKKKATVDEFPLCVHLMSNEREHLSSEALEAARICANKYMVKNCGKDGFHMRVRKHPYHVVRIN
STE10041|RPL10       MGRRPARCYRYCKNKPYPKSRFNRGVPDPKIRIYDLGRKKAMVDDFPLCVHMVSDEYEQLSGEAMEAARICANKYMVKSCGKDAFHIRIRTHPFHVVRIN
MBR10041|RPL10       MGRRPARCSRYCKNKPYPKSRFVRAVPDPKIRIYDLGRKRAHVMDFPLCVHMVSNEIEQISSEALEAARICCNKYLVKTVGKEGFHIRIRVHPFHVVRIN
NEU10042|Rpl10       MARRPARCYRYCKNKPYPKSRFNRGVPDPKIRIFDLGRKRATVDDFPLCIHMVSNEYEQLSSEALEAARICANKYLVKTAGKEGFHLRVRVHPYHVVRIN
GRI10041|Rpl10       MARRPARCYRYCKNKPYPKSRFNRGVPDPKIRIFDLGRKRATVDDFPLCIHLVSNEYEQLSSEALEAARICANKYLVKNAGKEGFHLRVRAHPYHVVRIN
GRA10042|Rpl10       MARRPARCYRYCKNKPYPKSRFNRGVPDPKIRIFDLGRKRANVDDFPLCIHLVSNEYEQLSSEALEAARICANKYLVKNTGKEGFHLRVRAHPFHVVRIN
STA10041|Rpl10       MARRPARCYRYCKNKPYPKSRFNRGVPDAKIRIFDLGRKKANVDDFPLCIHLVSNEYEQLSSESLEAARICANKYLVKVAGKEGFHMRIRVHPYHVVRIN
YAR10042|Rpl10       MARRPAKCYRYQKNKPFPKSRYNRAVPDPKIRIYDLGRKRAHVDDFPLCIHLVSNEREQLSSEALEAARICANKYITKVSGREAFHMRIRAHPFHVLRIN
POM10072|RPL10-1     MARRPARCYRYCKNKPYPKSRYNRAVPDSKIRIFDLGRKRAGVDEFPLCIHLVSNEYEQITSEALEAARICANKYLVKIGGKDSFHLRVRAHPFHVVRIN
POM10073|RPL10-2     MARRPARCYRYCKNKPYPKSRYNRAVPDSKIRIFDLGRKRAGVDEFPLCIHLVSNEYEQITSEALEAARICANKYLVKIGGKDSFHLRVRAHPFHVVRIN
YST10072|RPL10       MARRPARCYRYQKNKPYPKSRYNRAVPDSKIRIYDLGKKKATVDEFPLCVHLVSNELEQLSSEALEAARICANKYMTTVSGRDAFHLRVRVHPFHVLRIN
CIN10042|Rpl10       MGRRPARCYRYCKNKPYPKSRYNRGVPDPKIRIFDLGRKRANVDEFPFCAHLVSDEYEQLSSEALEAARICANKYMTKTSGKDSFHLRVRVHPFHVLRIN
NEA10041|Rpl10       MGRRPARCYRYCKNKPYPKSRYNRGVPDPKIRIYDLGRKKASVDDFPFCCHLVSDEYEQLSSEALEAARICANKYIVKNAGKEAFHMRVRVHPFHVIRIN
MAY10041|Rpl10       MGRRPARCYRYCKNKPFPKSRYNRGVPDPKIRIYDLGRKKASVDDFPFCAHLVCDEHQQITSEALEAARICANKYITKTSGKDSFHLRVRVHPFHVIRIN
RHI10155|Rpl10       MGRRPARCYRYCKNKPYPKSRYCRGVPDAKLRIYDLGRKKASVDDFPLCIHLVSNEYEQLSAEALEAGRICANKYMAKTSGKDSFHMRIRVHPYHVTRIN
RHI10156|Rpl10-2     MGRRPARCYRYCKNKPYPKSRYCRGVPDAKLRIYDLGRKKASVDDFPLCIHLVSNEYEQLSAEALEAGRICANKYMAKTSGKDSFHMRIRVHPYHVTRIN
RHI10157|Rpl10-3     MGRRPARCYRYCKNKPYPKSRYCRGVPDAKLRIYDLGRKKASVDDFPLCIHLVSNEYEQLSAEALEAGRICANKYMAKTSGKDSFHMRIRVHPYHVTRIN
RHI10158|Rpl10-4     MGRRPARCYRYCKNKPYPKSRYCRGVPDAKLRIYDLGRKKAAVDDFPLCVHLVSNEYEQLSAEALEAGRICANKYMAKTSGKDSFHMRIRVHPYHVTRIN
RHI10159|Rpl10-5     MGRRPARCYRYCKNKPYPKSRYCRGVPDAKLRIYDLGRKKASVDDFPLCIHLVSNEYEQLSAEALEAGRICANKYMAKTSGKDSFHMRIRVHPYHVTRIN
ARA10115|RPL10B      MGRRPARCYRQIKGKPYPKSRYCRGVPDPKIRIYDVGMKRKGVDEFPYCVHLVSWEKENVSSEALEAARIACNKYMVKSAGKDAFHLRIRVHPFHVLRIN
ARA10116|RPL10C      MGRRPARCYRQIKGKPYPKSRYCRGVPDPKIRIYDVGMKRKGVDEFPFCVHLVSWEKENVSSEALEAARIACNKYMVKSAGKDAFHLRIRVHPFHVLRIN
RIC10127|RPL10C      MGRRPARCYRQIKNKPYPKSRYCRGVPDPKIRIYDVGMKKKGVDEFPYCVHLVSWEKENVSSEALEAARIACNKYMTKNAGKDAFHLRVRVHPFHVLRIN
RIC10128|RPL10B      MGRRPARCYRQIKNKPYPKSRYCRGVPDPKIRIYDVGMKKKGVDEFSHCVHLVSWEKENVTSEALEAARIACNKYMTKSAGKDAFHLRVRVHPFHVLRIN
RIC10129|RPL10B      MGRRPARCYRQIKNKPYPKSRYCRGVPDPKIRIYDVGMKKKGVDEFSHCVHLVSWEKENVTSEALEAARIACNKYMTKSAGKDAFHLRVRVHPFHVLRIN
RIC10130|RPL10B      MGRRPVRCYRQIKNKPYPKSRYCRGVPDPKIRIFDVGQKKRSADDFPLCVHLVSWEKENVSSEALEAARIACNKYMAKHAGKDAFHLRVCAHPYHVLRIN
GMA10205|LOC10049968 MGRRPARCYRQIKNKPYPKSRFCRGVPDPKIRIYDVGMKKKGVDEFPFCVHLVSWEKENVSSEALEAARIACNKYMAKFAGKDAFHLRVRVHPFHVLRIN
GMA10206|LOC10081557 MGRRPARCYRQIKNKPYPKSRFCRGVPDPKIRIYDVGMKKKGVDEFPFCVHLVSWEKENVSSEALEAARIACNKYMAKFAGKDAFHLRVRVHPFHVLRIN
GMA10207|LOC10077719 MGRRPARCYRQIKNKPYPKSRFCRGVPDPKIRIYDVGMKKKGVDEFPFCVHLVSWEKENVSSEALEAARIACNKYMAKFAGKDAFHLRVRVHPFHVLRIN
GMA10209|LOC10030561 MGRRPARCYRQIKNKPYPKSRFCRGVPDPKIRIYDVGMKKKGVDEFPFCVHLVSWEKENVSSEALEAARIACNKYMAKFAGKDAFHLRVRVHPFHVLRIN
GMA10210|LOC10077988 MGRRPARCYRQIKNKPYPKSRFCRGVPEPKIRIYDVGMKKKGVDEFPFCVHLVSWEKENVSSEALEAARIACNKYMAKFAGKDAFHLRVRVHPFHVLRIN
POP10041|RPL10       MGRRPARCYRQIKNKPYPKSRYCRGVPDSKIRIYDVGMKRKGVDEFPFCVHLVSWEKENVSSEALEAARIACNKYMAKFAGKDAFHLRVRVHPFHVLRIN
CRE10041|RPL10       MGRRPARCYRQSKGKPYPKSRFCRGVPDPKIRIYDAGMKRADVDTFPCCVHLASWEKENVTSEALEAARVAANKYMVKNAGKEAFHLRVRVHPFHVLRIN
VOL10044|RPL10       MGRRPARCYRQSKGKPYPKSRFCRGVPDPKIRIYDAGMKRADVDTFPCCVHLASWEKENVSSEALEAARVAANKYMVKNAGKEAFHLRVRVHPFHVLRIN
HEM10038|rpl10       MGRRPWKCYRYCKNKPYPKSRYCRGVPDPKIRIFDLGNKKACIKEFPLSIHLVQEEQTQVSSESIEAGRVACNKYLINNAGKDSFHLRVRIHPFHVIRIN
PTR10043|RPL10       MGRRPARCYRYQKNKPYIKSRYCRGVPESKIRIFDVGAKKAPVDQFPFVAHLVCDEKQQISSEALEACRVAINKHLSKNIGKDAFHIRIRAHPFHVLRAN
TPS10041|Rpl10       MGRRPFRCYRYQKNKPYIKSRYCRGVPESKIRIYDVGAKKAPVDLFPFVAHLVCDEKQQISSEALEACRIAINKHLTNTVGKDGYHIRVRVHPFHVIRAN
CYA10042|RPL10       MGRRPARCYRYCKNKPYPKSRYCRGVPDPKIRIFDLGRKKAATDELPFCVNLVSDEREQLSSEALEAARVAANKYLTATAGKDGFHLRVRVHPFHVIRIN
DIC10041|RPL10       MGRRPARCYRYCKNKPYIKSRYCRGVPDAKIRIFDLGRKKASTDEFPLCVHLISLEKEQLSSEAIEAGRISCNKYISKTGGKDSFHMRVRVHPWHVLRIN
PLA10047|RPL10       MGRRPARCYRYCKNKPYPKSRYCRGVPDPKIRIYDMGRKKADVNEFSGVVHLVSYEYEQISSEALEAARISANKYMITNCGKDNFHLRVRIHPFHVLRIN
TGO10041|RPL10       MGRRPARCYRYCKNKPYPKSRFCRGVPDAKIRIYDAGRKRADVDEFPGVAHLVSDEYEQISSEALEAARVCANKYMIKNCGKDNFHLRIRVHPFHVLRIN
GIA10041|Rpl10       MGRRPARCYRYQKNKPYPKSRFCRGVPDPKIRYFDLGNRRAKVNDFPYCFHLLSGEKEQVSSEALEACRIACNKYIAKKAGKDSFHLRIRVHPFHVIRIN


HUM10042|RPL10       KMLSCAGADRLQTGMRGAFGKPQGTVARVHIGQVIMSIRTKLQNKEHVIEALRRAKFKFPGRQKIHISKKWGFTKFNADEFEDMVAEKRLIPDGCGVKYI
DOG10041|Rpl10       KMLSCAGADRLQTGMRGAFGKPQGTVARVHIGQVIMSIRTKLQNKEHVIEALRRAKFKFPGRQKIHISKKWGFTKFNADEFEDMVAEKRLIPDGCGVKYI
MUS10041|Rpl10       KMLSCAGADRLQTGMRGAFGKPQGTVARVHIGQVIMSIRTKLQNKEHVIEALRRAKFKFPGRQKIHISKKWGFTKFNADEFEDMVAEKRLIPDGCGVKYI
RAT10041|Rpl10       KMLSCAGADRLQTGMRGAFGKPQGTVARVHIGQVIMSIRTKLQNKEHVIEALRRAKFKFPGRQKIHISKKWGFTKFNADEFEDMVAEKRLIPDGCGVKYI
FUG10042|RPL10       KMLSCAGADRLQTGMRGAFGKPQGTVARVHIGQVIMSVRTKTQNKEHVVEALRRAKFKFPGRQKIHISKKYGFTKFNACDFDDMMADKRLIPDGCGVKYI
DAN10041|Rpl10       KMLSCAGADRLQTGMRGAFGKPQGTVARVHIGQVIMSVRTKAQNKEHVIEALRRAKFKFPGRQKIHVSKKYGFTKFNTCDFDNMLAEKRLIPDGCGVKYI
CIO10041|RPL10       KMLSCAGADRLQTGMRGAYGKPQGLVARVKIGQPIMSMRCKDSARAHAIEALRRAKFKFPGRQKIYDSPKWGFTKWNREDYERMLAEGLLIPDGVSCQYK
DRO10056|Qm          KMLSCAGADRLQTGMRGAFGKPQGTVARVRIGQPIMSVRSSDRYKAQVIEALRRAKFKFPGRQKIYVSKKWGFTKYERERYEELRDDNRLEPDGCNVKYR
MOS10041|Rpl10-1     KMLSCAGADRLQTGMRGAFGKPQGTVARVHIGQPIMSVRSSDRFKAQVIEALRRAKFKFPGRQKIFVSKKWGFTKYDRDVYQKHNDEGRLVPDGCGVQFR
MOS10042|Rpl10-2     KMLSCAGADRLQTGMRGAFGKPQGTVARVHIGQPIMSVRSSDRFKAQVIEALRRAKFKFPGRQKIFVSKKWGFTKYDRDVYQKHNDEGRLVPDGCGVQFR
BEE10043|Rpl10       KMLSCAGADRLQTGMRGAFGKPQGTVARVHIGQPIMSVRSSDRHKAAVVEALRRAKFKFPGRQKIYVSKKWGFTKYDRAEYEELKAAGRLAPDGCNVKYL
CEL10043|rpl-10      KMLSCAGADRLQTGMRGAYGKPQGLVARVDIGDILFSMRIKEGNVKHAIEAFRRAKFKFPGRQIIVSSRKWGFTKWDREDYERMRAEGRLRSDGVGVQLQ
BMA10041|RPL10       KMLSCAGADRLQTGMRGAFGKPQGLVARVDIGDILISVRVKEQHEEHAVEAFRRAKFKFPGRQLVVVSRKWGFTKWDKEEYETMRGEGRLVPDGATCKLV
STE10041|RPL10       KMLSCAGADRLQTGMRGAFGKPQGTVARVNIGQTIISIRTKDGNKAAAIEALRRAKFKFPGRQKLFVSRKWGFTKFDRDIYEQWRAEGKLIPDGVHAKYI
MBR10041|RPL10       KMLTCAGADRLQTGMRGAFGKPAGKVARVRIGQPIMSVRSRDANKDHVIEALRRSKMKFPGRQLIIVSRKWGFTKWDRDEFDKLRQEGRLVPDGCHCQLF
NEU10042|Rpl10       KMLSCAGADRLQTGMRGAWGKPNGTVARVNIGQIIMSVRTRDSNKAFALEALRRSQYKFPGRQKIIISKNWGFTPLRREEYLEKKAAGKLLIDGAYVQFL
GRI10041|Rpl10       KMLSCAGADRLQTGMRGAWGKPNGTVARVNIGQIILSVRTRDSNRALALEALRRSQYKFPGRQKIIISKNWGFTPLRREEYLEKKAAGRVKVDGAYVQFL
GRA10042|Rpl10       KMLSCAGADRLQTGMRGAWGKPNGTVARVNIGQILMSVRTRDANRAIALEALRRSQYKFPGRQKIIVSKNWGFTPLRREEYLDKKAAGRVKVDGAYVQFL
STA10041|Rpl10       KMLSCAGADRLQTGMRGAFGKPNGLVARVNIGQILMSVRTRDSHRATALEALRRCQYKFPGRQKIIVSRNWGFTPLRREEYVEKRQEGRIKIDGAYVQFL
YAR10042|Rpl10       KVLSCAGADRLAQGMRGAWGKPAGLAARVDIGQVLISIRTKDNNKATVIEGLRRCRYKFPGQQKIIISKKWGFTNLDREEYMTRRQNGEIKEDGAYVKFL
POM10072|RPL10-1     KMLSCAGADRLQTGMRHAFGKPNGLVARVNIGQILMSVRTKDSSRATAIEALRRCQYKFPGQQRIIVSKKWGFSQYARDEYIEKRSRGEIIPDGCYAKFL
POM10073|RPL10-2     KMLSCAGADRLQTGMRHAFGKPNGLVARVNIGQVLMSVRTKDSSRATAIEALRRCQYKFPGQQRIIVSKKWGFSQYARDEYIEKRSRGEIIPDGCYAKFL
YST10072|RPL10       KMLSCAGADRLQQGMRGAWGKPHGLAARVDIGQIIFSVRTKDSNKDVVVEGLRRARYKFPGQQKIILSKKWGFTNLDRPEYLKKREAGEVKDDGAFVKFL
CIN10042|Rpl10       KMLSCAGADRLQTGMRGAWGKPYGTVARVNIGQVILSIRSRDNNAHVVMEALRRARYKFPGRQKIIVSKKWGFTNVNKEEYLKLKEEKRVLQDGAYVQFI
NEA10041|Rpl10       KMLSCAGADRLQQGMRGAWGKPYGSVARVNIGQVIMSIRCRDNNRAVIIEALRRARYKFPGRQKIIVSKKWGFTPLDRAEYEALKANKQVINDGAYVQFL
MAY10041|Rpl10       KMLSCAGADRLQTGMRGAYGKPYDTVARVNIGQILLSVRTRDSNKAVVLEALRRSRYKFAGRQKIIISKKWGFTNMNREQYAEAKQSNRILKDGCYLQYI
RHI10155|Rpl10       KMLSCAGADRLQTGMRGAFGKPNGLVARVNIGQIIFSVRSKDSNKAVVIEALRRCKYKFPGQQKIIISKKWGFTPLDRADYVEARSKGLVKPDGCYVKFV
RHI10156|Rpl10-2     KMLSCAGADRLQTGMRGAFGKPNGLVARVNIGQIIFSVRSKDSNKAVVIEALRRCKYKFPGQQKIIISKKWGFTPLDRADYVEARSKGLVKPDGCYVKFV
RHI10157|Rpl10-3     KMLSCAGADRLQTGMRGAFGKPNGLVARVNIGQIIFSVRSKDSNKAVVIEALRRCKYKFPGQQKIIISKKWGFTPLDRADYVEARSKGLVKPDGCYVKFV
RHI10158|Rpl10-4     KMLSCAGADRLQTGMRGAFGKPNGLVARVNIGQIIFSVRSKDSNKAVVIEALRRCKYKFPGQQKIIISKKWGFTPLDRADYIEARSKGLVKPDGCYVKFV
RHI10159|Rpl10-5     KMLSCAGADRLQTGMRGAFGKPNGLVARVNIGQIIFSVRSKDSNKAVVIEALRRCKYKFPGQQKIIISKKWGFTPLDRADYVEARSKGLVKPDGCYVKFV
ARA10115|RPL10B      KMLSCAGADRLQTGMRGAFGKALGTCARVAIGQVLLSVRCKDAHGHHAQEALRRAKFKFPGRQKIIVSRKWGFTKFNRADYTKLRQEKRIVPDGVNAKFL
ARA10116|RPL10C      KMLSCAGADRLQTGMRGAFGKALGTCARVAIGQVLLSVRCKDNHGVHAQEALRRAKFKFPGRQKIIVSRKWGFTKFNRAEYTKLRAMKRIVPDGVNAKFL
RIC10127|RPL10C      KMLSCAGADRLQTGMRGAFGKPQGTCARVDIGQVLLSVRCKESNAKHAEEALRRAKFKFPGRQKIIHSRKWGFTKFTREEYVKLKAEGRIMSDGVNAQLL
RIC10128|RPL10B      KMLSCAGADRLQTGMRGAFGKPQGTCARVDIGQVLLSVRCKPNNAVHASEALRRAKFKFPGRQKIIESRKWGFTKFSRDEYVRLKSEGRIMPDGVNAKLL
RIC10129|RPL10B      KMLSCAGADRLQTGMRGAFGKPQGTCARVDIGQVLLSVRCKPNNAVHASEALRRAKFKFPGRQKIIESRKG-FTKFSRDEYVRLKSEGRIMPDGVNAKLL
RIC10130|RPL10B      KMLSCAGADRLQTGMRGAFGKPTGTCARVRIGQVLLSVRCRDANAAHAQEALRRAKFKFPGRQRVIFSAKWGFTRFKRDEYLKLKSEGRIVPDGVNAKLL
GMA10205|LOC10049968 KMLSCAGADRLQTGMRGAFGKPQGTCARVAIGQVLLSVRCKDSNSHHAQEALRRAKFKFPGRQKIIVSRKWGFTKFSRADYLKYKSESRIVPDGVNAKLL
GMA10206|LOC10081557 KMLSCAGADRLQTGMRGAFGKPQGTCARVAIGQVLLSVRCKDSNSHHAQEALRRAKFKFPGRQKIIVSRKWGFTKFSRADYLKYKSESRIVPDGVNAKLL
GMA10207|LOC10077719 KMLSCAGADRLQTGMRGAFGKPQGTCARVAIGQVLLSVRCKDSNSHHAQEALRRAKFKFPGRQKIIVSRKWGFTKFSRSDYLKFKSENRIVPDGVNAKLL
GMA10209|LOC10030561 KMLSCAGADRLQTGMRGAFGKPQGTCARVAIGQVLLSVRCKDSNSHHAQEALRRAKFKFPGRQKIIVSRKWGFTKFSRSDYLKFKSENRIVPDGVNAKLL
GMA10210|LOC10077988 KMLSCAGADRLQTGMRGAFGKPQGTCARVNIGQVLLSVRCKDANSHHAQEALRRAKFKFPGRQKIILSRKWGFTKFSRSEYLKLKSENRIVPDGVNAKVL
POP10041|RPL10       KMLSCAGADRLQTGMRGAFGKPQGTCARVAIGQVLLSVRCKDSNSHHAQEALRRAKFKFPGRQKIIVSRKWGFTKFNRNDYLKLKAENKIMSDGVNAKLL
CRE10041|RPL10       KMLSCAGADRLQTGMRGAFGKPNGVCARVQIGQVLMSIRCRDNHGAVAEEALRRAKFKFPGRQKIIRSNNWGFTNLSRKDFKIFREEGRLINDGSHVKVI
VOL10044|RPL10       KMLSCAGADRLQTGMRGAFGKPTGTCARVQIGQVLMSIRCRDQHGAVAEEALRRAKFKFPGRQKIIRSNNWGFTTLTRKDYKLYREEGRLINDGSHVKLI
HEM10038|rpl10       KMLSCAGADRLQSGMRGAFGKPIGTAARVARGQILFSVRSKNENTLKIIEALRRAKYKFPGRQKIFVSQMWGFSKIVKNNFEKLLTNNSLKNKKKLVYDG
PTR10043|RPL10       KMLSCAGADRLSSGMRHSYGKPIGVAARVDIGQILISVRSKDTHEAHVIEAIRRGKFKFAGRQKILKSLKWGFTSYPREEYVRMRRCGELSADGNIVKVH
TPS10041|Rpl10       KMLSCAGADRLSSGMRHSYGKPIGVAARVDIGQILLSVRAKDASEPHVVEAIRRGKFKFAGRQKILKSLKWGFTKYQREDYVKMRKNGELAADGNIVKVH
CYA10042|RPL10       KMLSCAGADRLQTGMRGAFGKPQGTVARVDIGQILMSVRVKEQHVEAAKEALRRSKYKFPGRQRIYVSRYWGFTRFTREEYEKLRAEGKLIEDGGNVKLI
DIC10041|RPL10       KMLSCAGADRLQTGMRGAFGKPMGTVARVNIGQIIFSIRTRDNMLANVVEALRRSSYKFPGRQKIVVSKKWGFTAYNREAYQKLKADGRLMNDGANVKVI
PLA10047|RPL10       KMLSCAGADRLQTGMRGAFGKPNGVVARVDIGQVLLSIRTKENFVSKACEALRRAKYKFPGRQKVFVSNKWGFTPFSKDEYQQYKKKGRIISDGVSCKFI
TGO10041|RPL10       KMLSCAGADRLQTGMRGAFGKPMGLVARVDIGQILMSIRTRESNVATAVTALRRAAFKFPGRQKVFVSNKWGFTKFTKVEYKKWQAEGRIVSDGVGAKWI
GIA10041|Rpl10       KMLSCAGADRLQTGMRGAWGKPQGTVARVSIGQPLLSVRCRASAKDYVKDALRRAKFKIPGRQAIVESRNWGFTEFTKEEYEDLRERGELQYDGNNAHRI


HUM10042|RPL10       PSRGPLDKWRALHS------------------
DOG10041|Rpl10       PNRGPLDKWRALHS------------------
MUS10041|Rpl10       PNRGPLDKWRALHS------------------
RAT10041|Rpl10       PNRGPLDKWRALHS------------------
FUG10042|RPL10       PNKGPLSRWRALHAN-----------------
DAN10041|Rpl10       PSRGPLSRWKALHAN-----------------
CIO10041|RPL10       PNKGKLDLWKKRQ-------------------
DRO10056|Qm          PEHGPIAAWEKAQRDVYA--------------
MOS10041|Rpl10-1     NDHGPLVKWEQHQRNRLSA-------------
MOS10042|Rpl10-2     NDHGPLVKWEQHQRNRLSA-------------
BEE10043|Rpl10       PEHGPLDEWKKFRKVLAAA-------------
CEL10043|rpl-10      REHGPLTKWIENPI------------------
BMA10041|RPL10       REHGPLSKWIHNPI------------------
STE10041|RPL10       SGHGPLAAWKKLNS------------------
MBR10041|RPL10       SEKGPLTKWYRHEAR-----------------
NEU10042|Rpl10       GNRGSLERNMKRFPDAFATEA-----------
GRI10041|Rpl10       ANHGSLENNMKRFPEAFAA-------------
GRA10042|Rpl10       SNHGSLERNIRRFPDAFKSEA-----------
STA10041|Rpl10       RNKGNLAQNMRRFPDAFSAEA-----------
YAR10042|Rpl10       TKKGPLAESLAEFPDYNGVSV-----------
POM10072|RPL10-1     NKRGSLQEKLDLFPEASFNLA-----------
POM10073|RPL10-2     NKRGSLQEKLDLFPEASFNLA-----------
YST10072|RPL10       SKKGSLENNIREFPEYFAAQA-----------
CIN10042|Rpl10       RPKGNLEQNLRNQLRA----------------
NEA10041|Rpl10       KPKGPLLQNLRTAERA----------------
MAY10041|Rpl10       NNHGPLEQNLRLQARVAAQK------------
RHI10155|Rpl10       PQKGSLANYFKEAVKAI---------------
RHI10156|Rpl10-2     PQKGSLANYFKEAVKA----------------
RHI10157|Rpl10-3     PQKGSLANYFKEAVKA----------------
RHI10158|Rpl10-4     PQKGSLSNYFKEVSRV----------------
RHI10159|Rpl10-5     PQKGSLANYFKEAVKA----------------
ARA10115|RPL10B      SCHGPLANRQPGSAFLSAGAQ-----------
ARA10116|RPL10C      SNHGPLANRQPGSAFISATSE-----------
RIC10127|RPL10C      GSHGRLAKRAPGKAFLAETIQASA--------
RIC10128|RPL10B      GCHGRLSARAPGKAFLSAA-------------
RIC10129|RPL10B      GCHGRLSARAPGKAFLSAA-------------
RIC10130|RPL10B      TRHGSVADRQPGRGVFPPSVAGSDA-------
GMA10205|LOC10049968 GCHGPLANRQPGQAFLSSATATA---------
GMA10206|LOC10081557 GCHGPLANRQPGQAFLSSATATA---------
GMA10207|LOC10077719 GCHGPLANREPGRAFLDTATGS----------
GMA10209|LOC10030561 GCHGPLANREPGRAFLDTATSS----------
GMA10210|LOC10077988 GCHGPLANREPGRAFLPATA------------
POP10041|RPL10       GCHGPLANRQPGRAFLSATA------------
CRE10041|RPL10       TNKGPLAEREPDHIFDYPAFKHHTPLHKDE--
VOL10044|RPL10       NHKGPLAEREPDHIFDYPARLHHIPHHKVDSE
HEM10038|rpl10       CFFKLLK-------------------------
PTR10043|RPL10       NRRGPLEKSALYKAGQE---------------
TPS10041|Rpl10       NRHGLLEKSALYLAGQE---------------
CYA10042|RPL10       RPHGPLPTPPVTAQ------------------
DIC10041|RPL10       TNHGTLAQYAKDIAAAN---------------
PLA10047|RPL10       REKGPLDKIYKDINTVLES-------------
TGO10041|RPL10       STKGPLANTFPSAADITLPVA-----------
GIA10041|Rpl10       SRKGPLNLKL----------------------