CLUSTAL W (2.1) Multiple Sequence Alignments
HUM10043|RPL10A      ---MSSKVSRDTLYEAVREVLHGNQ------------RKRRKFLETVELQISLKNYDPQKDKRFSGTVRLKSTPRPKFSVCVLGDQQHCDEAKAVD-IPH
DOG10042|Rpl10a      ---MSSKVSRDTLYEAVREVLHGNQ------------RKRRKFLETVELQISLKNYDPQKDKRFSGTVRLKSTPRPKFSVCVLGDQQHCDEAKAVD-IPH
MUS10042|Rpl10a      ---MSSKVSRDTLYEAVREVLHGNQ------------RKRRKFLETVELQISLKNYDPQKDKRFSGTVRLKSTPRPKFSVCVLGDQQHCDEAKAVD-IPH
RAT10042|Rpl10a      ---MSSKVSRDTLYEAVREVLHGNQ------------RKRRKFLETVELQISLKNYDPQKDKRFSGTVRLKSTPRPKFSVCVLGDQQHCDEAKAVD-IPH
CHK10044|Rpl10a      ---MSSKVSRDTLYEAVKEVLQGSK------------TKKRKFVETVELQISLKNYDPQKDKRFSGTVRLKSTPRPKFSVCLLGDQQHCDEAKAVE-IPH
FUG10043|RPL10A      ----MSKVSRDTLYEAVKEVLQGTL------------AKPRKFVESVELQISLKNYDPQKDKRFSGTVRLKTLPRPKFSVCVLGDQQHCDEAKAAD-LPH
DAN10042|Rpl10a      ----MSKVSRDTLYEAVKEVQAGSR------------RKKRKFLETVELQISLKNYDPQKDKRFSGTVRLKTTPRPKFSVCVLGDQQHCDEAKAAE-LPH
MED10042|Rpl10a      ----MSKVSRDTLYEAVKEVLQGSV------------AKPRKFTESVELQISLKNYDPQKDKRFSGTVRLKTLPRPKFSVCVLGDQQHCDEAKAAD-MPH
CIO10042|RPL10A      ----MSKVSRDTLYECVENILKGSK------------TKQRKFLESVELQISLKNYDPQKDKRFSGTVKLPNLPRNKFRICVLGDAQHCDEANANN-IAC
DRO10059|RpL10Ab     ---MASKVSRDTLYEGVNGLLEASA------------KKKRGFLETVELQIGLKNYDPQKDKRFSGTVKLKHIPRPKMKVCILGDQQHCDEAKANN-VDF
DRO10060|RpL10Aa     ---MVSKVSRDTIYVAVKNILLNSQ------------AKGPDCLETVELQIGLRDYDPDKCKRFHGSVLLHHLAVPQLKVCVFGDQEHCYKAKAIG-VDC
MOS10043|Rpl10a      ---MASKVSRDILYECVAEVLKGAE------------TKRRRFLETVELQIGLKNYDPQKDKRFSGTVKLKYIPRPKMQVCVLGDQQHCDEAKAND-IPF
BEE10044|Rpl10a      ---MTSKVSRDTLYECVNAVLQHSQ------------DKKRKFLETVELQIGLKNYDPQKDKRFSGTVKLKNIPRPKMQVCVLGDQQHCDEAKANN-IPY
CEL10044|rpl-1       ----MSKVSRESLNEAIAEVLKGSS------------EKPRKFRETIELQIGLKNYDPQKDKRFSGSIRLKHIPRPNMKVCVFGDQHHLDEAAAGD-IPS
BMA10042|RPL10A      ----MSKIPRDTLFECVNEVLKASK------------EKKRKFRETVELQVALKNYDPQKDKRFSGSVRLKNIPRPNMKVCVLGDQQHCDEANANS-IPC
STE10042|RPL10A      ----MSKISRDNLYECVGAVLQGSK------------DKPRKFTETVELQIALKNYDPQKDKRFSGTVKLKTIPRPQMKVCVLGDASHCDEANANE-IPC
MBR10042|RPL10A      ----MSKISRETYEEAVSSLLSYSQ------------EKKRNFVESVELQIMLKNYDPSKDKRFSGSIRLPAIARPRLTVCVLGDESHCDEAKAAN-LPF
NEU10043|Rpl10a      ----MSKISVAAVRQHVTDLLEYSN-----------ETKKRNFLETVELQIGLKNYDPQRDKRFSGTIRLPSIPRPNMSICILGDQHDIDRAKHGG-VDA
GRI10042|Rpl10a      ----MSKITVAGVRSNVGELLDYSL-----------NTKKRNFLETVELQIGLKNYDPQRDKRFSGTIKLPVVPRPNMAICILGDQHDLDRAKHGG-IDS
GRA10043|Rpl10a      ----MSKITVANVRTQVGELLEYSN-----------ETKKRNFLETVELQIGLKNYDPQRDKRFSGSIRLPSIPRPNMSICILGDQHDIDRAKHGG-VDA
STA10042|Rpl10a      ----MSKISVAGVRGNVKELLEYSN-----------ETKKRNFLETVELQIGLKNYDPQRDKRFSGTVKLPTVPRPRMALCVLGDQHDIDRAKHHG-VDA
YAR10043|Rpl10a      ---MSSKITVAGVRGNVQKLLEQS------------ETKKRNFLETVELQIGLKNYDSQRDKRFSGTIKLPKVPRPNMTICVFGDALDVDRAKSVG-VDA
POM10074|RPL10A-1    ----MSKVSVASVRSNVEQILKGS------------EEKKRNFTETVELQIGLKNYDPQRDKRFSGTIKLPNVPRPNMAICILGDAHDLDRAKHGG-VDA
POM10075|RPL10A-2    ----MSKVSPANIRSSVETILKGS------------EEKKRNFTETVELQIGLKNYDPQRDKRFSGTIKLPNVPRPNMSICILGDAHDLDRAKHGG-VDA
YST10073|RPL1A       ----MSKITSSQVREHVKELLKYSN-----------ETKKRNFLETVELQVGLKNYDPQRDKRFSGSLKLPNCPRPNMSICIFGDAFDVDRAKSCG-VDA
YST10074|RPL1B       ----MSKITSSQVREHVKELLKYSN-----------ETKKRNFLETVELQVGLKNYDPQRDKRFSGSLKLPNCPRPNMSICIFGDAFDVDRAKSCG-VDA
CIN10043|Rpl10a      --MSGSKLSVSSVRGSIKELLAES------------AEKKRNFVETIELQIGLKNYDPQRDKRFSGTVQLPNIPRPRMSICILADANDIDRAKQIE-LEY
NEA10042|Rpl10a      ----MSKLQASSVRGSIRTVLDQSSLENHKEA----GGKKRNFVETIELQIGLKNYDPQRDKRFSGTVKLPHVPRPRMSLCILADAMDVDRLQLDEELPF
MAY10042|Rpl10a      ----MSKIQVSSVRNTLKELIQAS------------EDKRRNFNETVELQIGLKNYDPQRDKRFSGTVKLPHVPRPRMSLCILADAADVDRAKLIN-LEF
RHI10160|Rpl10a      ----MSKVSASAVRDIVNEILKGSE------------EKKRNFTETIELQIGLKNYDPQRDKRFSGTIKLPHVARPRMTVCVLGDAFHCDQAKGAG-MEF
RHI10161|Rpl10a-2    ----MSKVSASAVRDIVNAIQAGAQ------------EKQRKFVQTVELQIGLKNYDPQRDKRFSGTIKLPHVARPRMTVCVLGDAFHCDQAKGAG-MEF
ARA10118|RPL10Ab     ----MSKLQSEAVREAITTIKGKSEEKK------------RNFVETVELQIGLKNYDPQKDKRFSGSVKLPHIPRPKMKICMLGDAQHVEEAEKMG-LSN
ARA10119|RPL10Ac     ----MSKLQSEAVREAISSIITHCKETKP-----------RNFTETIELQIGLKNYDPQKDKRFSGSVKLPHVPRPKMKICMLGDAQHVEEAEKIG-LES
RIC10132|RPL10Ac     ----MSKLQTEALKEAISQVVADCKEKN------------RKFTETVELQIGLKNYDPQKDKRFSGSVKLPHIPRPKMKVCMLGDAQHVEEAEKIG-LDY
RIC10133|RPL10Ac     ----MSKLQSEVLKEAISQVVGESKEKG------------RKFTETVELQIGLKNYDPQKDKRFSGSVKLPHIPRPKMKVCMLGDAQHVEEAEKIG-LDY
RIC10134|RPL10Ac     ----MSKLQSDALREAISQIANDSREKQ------------RKFVETIELQIGLKNYDPQKDKRFSGSVKLPHIPRPKLKVCMLGDAQHVEEAEKMG-LDY
GMA10213|LOC10030555 ----MSKLQSDALREAISGIMTDSKEKN------------RKFVETIELQIGLKNYDPQKDKRFSGSVKLPHIPRPKMKICMLGDAQHVEEAEKIG-LDY
GMA10214|LOC10052769 ----MSKLQSDALREAISGIMADSKEKN------------RKFVETIELQIGLKNYDPQKDKRFSGSVKLPHIPRPKMKICMLGDAQHVEEAEKIG-LDY
GMA10215|LOC10052776 ----MSKLQSDALREAISQVVSNSKEKN------------RKFTETIELQIGLKNYDPQKDKRFSGSVKLPHIPRPKMKICMLGDAQHVEEAEKIG-LDY
GMA10216|LOC10080858 ----MSKLQSDALREAISGIMADSKEKN------------RKFVETIELQIGLKNYDPQKDKRFSGSVKLPHIPRPKMKICMLGDAQHVEEAEKIG-LDW
GMA10217|LOC10049971 ----MSKLQSDALREAISGIMADSKEKN------------RKFVETIELQIGLKNYDPQKDKRFSGSVKLPHIPRPKMKICMLGDAQHVEEAEKIG-LDW
POP10042|RPL10A      ----MSKLSGDTIREAVTTIKTGVNEKP------------RKFVQTIELQIGLKNYDPQKDKRFSGSVKLPHIPRPKMKVCMLGDAQHVEEATSIG-LQW
CRE10042|RPL10A      ----MSKISNDVLRESVSALVEGAKTKP------------RKFQETVELQIGLKNYDPQKDKRFSGSVRLPFVPRPRMRVCVLGDVKHCEQAGAIG-VDA
VOL10045|RPL10A      ----MSKLSSDVLRESVSNVVEGSKAKP------------RKFLETIELQIGLKNYDPQKDKRFSGSVKLPFVPRPRMKVCVLGDVKHCEQAGAIG-VDA
HEM10039|rpl10A      ---MSSKITNETIEKAVLKIIKEAG------------VKKRKFSETIEMQIGLKNYDPKKDKRFSGTLTLPYIPKENRKVAILGDAVHLREAISAN-VDG
PTR10044|RPL10A      ----MSKLDSVLLEKAIGDVLAFSAGDEVSFGGESKQGKKRNFTETIEAQITLKNYDPVRDKRFSGTFRLPTVPRPQLKCCVLGNAAHCEQADRIG-VDH
TPS10042|Rpl10a      ---MSNKLNSALLDKAVEDILAFSAGETITKGGEELKGKKRNFTETIEIQITLKNYDPQRDKRFSGTFRLPAIPRPNIKCCMLGNAAHCEQADRIG-VAH
CYA10043|RPL10A      ---MTSKLPVSVTRAAVQEMLRESRE-----------ERKRNFVETVELQVGLKNYDPQKDKRFSGSVKLPYIPRPKMKVAVLGDAAHNAQAAALG-IDF
DIC10042|RPL10A      ----MSKISSDQVRSIVSQLFKEAQ------------ESKRGFLETVELQINLKNYDTKKDKRFSGQIKIGTVTKPKLSVCVFADQQHCDEATKIG-AEF
PLA10049|RPL10A      ----MSKLNQDLLKKAISDVFEGTKQKK------------RKFVETIELQIGLKDYDTQRDKRFSGTVRLSNEVRKKLKVCILGDAVHVEEAQKLE-LDY
TGO10042|RPL10A      ----MSKLSTDGLKKAIGEILEGSREKK------------RKFVETVELQIGLKDYDTQRDKRFSGSVRLPNVPRPRMRVCVMGDAVHCEQAKELG-LEF
GIA10042|Rpl10a      MGFAMQRINPEALNKHIAEIIERATN-----------EKPRKFLETVELQVGLKGYDPKKDPRFNLPLVLPHIAKQNLKLCVIADARDADRAKKLG-LNY


HUM10043|RPL10A      MDIEALKKLN-KNKKLVKKLAKKYDAFLASESLIKQIPRILGPGLNKAGKFPSLLTHNENMVAKVDEVKSTIKFQMKKVLCLAVAVGHVKMTDDELVYNI
DOG10042|Rpl10a      MDIEALKKLN-KNKKLVKKLAKKYDAFLASESLIKQIPRILGPGLNKAGKFPSLLTHNENMVAKVDEVKSTIKFQMKKVLCLAVAVGHVKMTDDELVYNI
MUS10042|Rpl10a      MDIEALKKLN-KNKKLVKKLAKKYDAFLASESLIKQIPRILGPGLNKAGKFPSLLTHNENMVAKVDEVKSTIKFQMKKVLCLAVAVGHVKMTDDELVYNI
RAT10042|Rpl10a      MDIEALKKLN-KNKKLVKKLAKKYDAFLASESLIKQIPRILGPGLNKAGKFPSLLTHNENMVAKVDEVKSTIKFQMKKVLCLAVAVGHVKMTDDELVYNI
CHK10044|Rpl10a      MDIEALKKLN-KNKKLVKKLAKKYDAFLASESLIKQIPRILGPGLNKAGKFPSLLTHNENLVAKVDEVKSTIKFQMKKVLCLAVAVGHVKMTEDELVYNI
FUG10043|RPL10A      MDIEALKKLN-KNKKMVKKLAKKYDAFLASESLIKQIPRILGPGLNKAGKFPSLLTHNENMMTKVDEVKSTIKFQMKKVLCLAVAVGHVKMTEDELVYNI
DAN10042|Rpl10a      MDIEALKKLN-KNKKLVKKLAKKYDAFLASESLIKQIPRILGPGLNKAGKFPSLLTHNENLGTKVDEVKSTIKFQMKKVLCLAVAVGHVKMSEEELVYNI
MED10042|Rpl10a      MDIEALKKLN-KNKKMVKKLAKKYDAFLASESLIKQIPRILGPGLNKAGKFPSLLTHNENLNTKVDEVKSTIKFQMKKVLCLAVAVGHVKMTEDELVYNI
CIO10042|RPL10A      MNVESLKKLN-KDKKLIKKLAKKYDAFLASESLIKQIPRLLGPGLNKAGKFPSLVTHQESLASKIHDVKSTIKFQMKKVLCLAVAIGNVNMTEDELVQNL
DRO10059|RpL10Ab     MDAEALKKLN-KNKKLVKKLAKSYDAFLASESLIKQIPRLLGPGLNKAGKFPALLSHQESMIGKIEEVKSTIKFQMKKVLCLSVAVGHVGMKSDELAQNV
DRO10060|RpL10Aa     LDVEALKKLN-KDPKLTKKLSKAYDVFLASESIIKQIPRLLGPGLTNAGKFLTPLARGESMSSKIK-ILSTKKKHMKRMECLSVNVGHVGMHPEELARNI
MOS10043|Rpl10a      MDAEALKKLN-KNKKLVKKLAKKYDAFLASESLIKQIPRLLGPGLNKAGKFPGLLGHGESMVQKIDEVKATIKFQMKKVLCLSVAVGHVKMSPDELAQNV
BEE10044|Rpl10a      MDAEALKKLN-KNKKLVKKLAKKYDAFLASESLIKQIPRILGPGLNKAGKFPGLLSHQESMVGKIDEVKATIKFQMKKVLCLSVAVGHVEMTPDELVQNV
CEL10044|rpl-1       MSADDLKKLN-KQKKLIKKLAKSYDAFIASESLIKQIPRILGPGLNKAGKFPSVVTHGESLQSKSDEIRATVKFQMKKVLCLSVAVGHVGLTQEELVSNI
BMA10042|RPL10A      MNADELKKLN-KNKKLIKKLAKGYDAFLASEALIKQIPRILGPGLNKAGKFPSVVAHSEPLITKIEEIRSTIKFQMKKVLCLSVAIGHVGMTPEELVSNI
STE10042|RPL10A      MDAEALKKLN-KNKKLVKKLAKKYDAFLASDSLIKQIPRILGPGLNKAGKFPTPINHNENMVQKIEDVRSTIKFQMKKVLCLAVAIGHVNMTEEQLAGNV
MBR10042|RPL10A      MDVEALKKLK-KNKKLVKKLAKKYDAFLASSTLIKQIPRILGPGLNKAGKFPTSVSHGESLEDKVNEIRGTIKFQMKKVLTLGVAVGHVGMDQEELIRNI
NEU10043|Rpl10a      MSVDDLKKLN-KNKKLIKKLARKYDAFVASEALIKQIPRLLGPGLSKAGKFPTPVSHSDDLTGKLNEVKSTIKFQLKKVLCMGVAVGNVGMTQEQLVGNI
GRI10042|Rpl10a      MSADDLKKLN-KNKKLIKKLARKYDAFIASDTLIKQIPRLLGPGLSKAGKFPTPVSHADDLSGKVTEVKSTIKFQLKKVLCMGVAVGNVEMTQEQLVGNI
GRA10043|Rpl10a      MSADDLKKLN-KNKKLIKKLARKYDAFVASEALIKQIPRLLGPGLSKAGKFPTPVSHADDLTGRINEVKSTIKFQLKKVLCMGVAVGNVEMSQEQLVGNI
STA10042|Rpl10a      MSTDDLKKLN-KNKKLIKKLARKYDAFISSDALIKQIPRLLGPGLSKAGKFPTPVSHNEDLANKMTEVKSTIKFQLKKVLCMGVAIGNVGMTEDELIGNI
YAR10043|Rpl10a      MSVEDLKKLN-KNKKLIKKLAKKYNAFIASEALIKQVPRLLGPQLSKAGKFPTPVSHNEDLHTKVNDVRSTVKFQLKKVLCMAVAVGHVEMTEDELTTQI
POM10074|RPL10A-1    MSVDDLKKLN-KNKKLVKKLAKKYDAFIASEVLIKQIPRLLGPGLSKAGKFPSPVSHADDLYGKITEVKSTIKFQLKKVLCLGVAVGHVEMSEEQLIANI
POM10075|RPL10A-2    MSVDDLKKLN-KNKKLVKKLAKKYDAFIASEVLIKQIPRLLGPGLSKAGKFPSPVSHSDDLYGKIIEVKSTIKFQLKKVLCLGVAVGHVDMAEEQLAANL
YST10073|RPL1A       MSVDDLKKLN-KNKKLIKKLSKKYNAFIASEVLIKQVPRLLGPQLSKAGKFPTPVSHNDDLYGKVTDVRSTIKFQLKKVLCLAVAVGNVEMEEDVLVNQI
YST10074|RPL1B       MSVDDLKKLN-KNKKLIKKLSKKYNAFIASEVLIKQVPRLLGPQLSKAGKFPTPVSHNDDLYGKVTDVRSTIKFQLKKVLCLAVAVGNVEMEEDVLVNQI
CIN10043|Rpl10a      MSVDDLKKLN-KNKKLVKKLAKKYDAFLASEALIRQIPRLLGPGLSKAGKFPTPVSHAEDLTNKVAEVRSTIKFQLKKVLCLGVAVGHVNMNDDQVLTNV
NEA10042|Rpl10a      MTVEDLKKLN-KNKKLVKKLAQKYDAFLASEALIKQIPRLLGPGLSKAGKFPTPVSHSEDLARKINDVRSTIKFQLKKVLCLGVAIGHVNMTEDQVMQNV
MAY10042|Rpl10a      MTVEDLKKLN-KNKKLVKKLAKKYDAFLASEALIKQIPRLLGPGLSKAGKFPTPVSHNEDLEKKVTEVKSTIKFQLKKVLCLGVAIGHVQMSDDQLLANV
RHI10160|Rpl10a      QSVDDLKKLN-KNKKLIKKLAKKYDAFLASEALIKQIPRLLGPGLHKVGKFPTPVSHNDSLTDKANEIRATIKFQLKKVLCLGVAVGHVAMTEDQLIANI
RHI10161|Rpl10a-2    QSVDDLKKLN-KNKKLIKKLAKKYDAFLASEALIKQIPRLLGPGLHKVGKFPTPVSHNDSLTDKANEIRATIKFQLKKVLCLGVAVGHLDMTEDQLVANI
ARA10118|RPL10Ab     MDVEALKKLN-KNKKLVKKLAKSYHAFLASESVIKQIPRLLGPGLNKAGKFPTLVSHQESLEAKVNETKATVKFQLKKVLCMGVAVGNLSMEEKQLFQNV
ARA10119|RPL10Ac     MDVEALKKLN-KNKKLVKKLAKKFHAFLASESVIKQIPRLLGPGLNKAGKFPTLVSHQESLESKVNETKATVKFQLKKVLCMGVAVGNLSMEEKQIFQNV
RIC10132|RPL10Ac     MDVEALKKMN-KNKKLVKKLAKKYHAFLASEAIIKQIPRLLGPGLNKAGKFPTLVTHQESLESKVNETKATVKFQLKKVLCMGVAVGNLSMEEKQIQQNI
RIC10133|RPL10Ac     MDVEALKKMN-KNKKLVKKLAKKYHAFLASEAIIKQIPRLLGPGLNKAGKFPTLVTHQESLESKVNETKATVKFQLKKVLCMGVAVGNLSMEEKQIQQNI
RIC10134|RPL10Ac     MDVEALKKMN-KNKKLVKKLAKKYHAFLASEAIIKQIPRLLGPGLNKAGKFPTLVTHQESLESKVNETKATVKFQLKKVLCMGVAVGNCAMEEKQIFQNV
GMA10213|LOC10030555 MDVEALKKLN-KNKKLVKKLAKKYHAFLASEAVIKQIPRLLGPGLNKAGKFPTLVTHQESLESKVNETKAMVKFQLKKVLCMGVAVGNVSMEEKQIFQNV
GMA10214|LOC10052769 MDVEALKKLN-KNKKLVKKLAKKYHAFLASEAVIKQIPRLLGPGLNKAGKFPTLVTHQESLESKVNETKAMVKFQLKKVLCMGVAVGNVSMEEKQIFQNV
GMA10215|LOC10052776 MDVEALKKLN-KNKKLVKKLAKKYHVFLASEAVIKQIPRLLGPGLNKAGKFPTLVTHQESLESKVNETKAMVKFQLKKVLCMGVAVGNCTMEEKQIFQNV
GMA10216|LOC10080858 MDVEALKKLN-KNKKLVKKLAKKYHAFLASEAVIKQIPRLLGPGLNKAGKFPTLVTHQETLESKVNESKAMVKFQLKKVLCMGVAVGNVSMEEKQIFQNV
GMA10217|LOC10049971 MDVEALKKLN-KNKKLVKKLAKKYHAFLASEAVIKQIPRLLGPGLNKAGKFPTLVTHQETLESKVNESKAMVKFQLKKVLCMGVAVGNVSMEEKQIFQNV
POP10042|RPL10A      MDVEALKKLN-KNKKLVKKLSKQYHAFLASESVIKQIPRLLGPGLNKAGKFPTLVNHQESLESKVNEIKATVKFQLKKVLCMGVAVGNCDMEDKQIFQNV
CRE10042|RPL10A      KGVEDLKKLN-KNKKLVKKLAQAYHAFLASDSVIKQIPRLLGPGLNKAGKFPAPIN--KNLEEMVLDTKCSIKFQLKKVLCMGVAVANVGMTEGEIRTNI
VOL10045|RPL10A      KGVEDLKKLN-KNKKLVKKLAQGYHAFLASDSVIKMIPRLLGPGLNKAGKFPAPIN--KNLEEMVNETKCSIKFQLKKVLCMGVAVANVGMTEGEIRTNI
HEM10039|rpl10A      YGLEDLKKFN-KQKKVIKKFSRKYDFFLASDSIIRSIPRILGPGLNKAGKFPLLVTHSEDLLEKVNSIKSNIKFELKKVLCLGVSIGNVEMDLEKLKHNI
PTR10044|RPL10A      MSVEDLKKLN-KNKKLVKKLAKRYDFFLASDNMIRQIPRLLGPGLTKAGKFPTLLSGSDDMQEKIDEQKATIKFQMKKVMCLNVAVGNVGQDPKEIIVNT
TPS10042|Rpl10a      MSTEDLKKLN-KNKKLVKKLAKKYDFFLASDNMIKQIPRLLGPGLTKAGKFPTLLAGGEDMQEKIDEVKSTIKFQMKKVMCLNVAIGNVDMDKQQIIVNT
CYA10043|RPL10A      YDLEKLKQFN-KQKKPIKKFAKSYDAFLASESVIRQIPRVLGPGLNKAGKFPTLIASNETVEAKVNEVKATIKFQLKKVLCLAVAVGNVQMTEDELVANI
DIC10042|RPL10A      MDIEALKKIGPKNKKAIKKLSKKYDAFLASESILRQVPKLLGPGLNKVGKFPTLLTHSEDMASKINDVKSTVKFQLKKVLCLAVAVGHIELTEREVATNI
PLA10049|RPL10A      MDIEAMKKLN-KDKTLVKKLAKKYDAFLASQVILPQIPKLLGPGLNKAGKFPSLITHNDKINDKILELKSSIKFQLKKVLCMGVPVGHANLKEEELRSNI
TGO10042|RPL10A      MDVEAMKKLN-KNKKLVKKLARKYDAFLASQVLIPQIPRLLGPGLNKAGKFPTLITHNDKLEDKIQEIKSSIKFQLKKVLCMGVAVGNVEMTEEQLRVNL
GIA10042|Rpl10a      VEIEHLQQFN-KDAKQIKKFAKSYDVFLASKSLIRQITVYAGPGFTKAGRTPLPLAPDEDLELKVLECKSTIKVQFKKAVGLNWPIGNVKMPASEIAQNI


HUM10043|RPL10A      HLAVNFLVSLLKKNWQNVRALYIKSTMGKPQRLY-
DOG10042|Rpl10a      HLAVNFLVSLLKKNWQNVRALYIKSPMGKPQRLY-
MUS10042|Rpl10a      HLAVNFLVSLLKKNWQNVRALYIKSTMGKPQRLY-
RAT10042|Rpl10a      HLAVNFLVSLLKKNWQNVRALYIKSTMGKPQRLY-
CHK10044|Rpl10a      HLAINFLVSLLKKNWQNVRALYIKSTMGKPQRLY-
FUG10043|RPL10A      HLAVNFLVSLLKKNWQNVRALYIKSTMGKPQRLY-
DAN10042|Rpl10a      HLAVNFLVSLLKKNWQNVRALYIKSTMGKPQRLY-
MED10042|Rpl10a      HLAVNFLVSLLKKNWQNVRALYIKSTMGKPQRLY-
CIO10042|RPL10A      NLAINFLVSLLKKNWQNVRSLYVKSTMGRPQRLY-
DRO10059|RpL10Ab     NLSINFLVSLLKKNWQNVRSLHVKSSMGPPQRLY-
DRO10060|RpL10Aa     AISINFLVSLLKDNWQNVRSLHIKSSLGVPHQLY-
MOS10043|Rpl10a      HLAINFLVSLLKKHWQNVRSLHIKSSMGAAQRLY-
BEE10044|Rpl10a      HLSINFLVSLLKKHWQNVRSLHIKSSMGPPQRLY-
CEL10044|rpl-1       SLSINFLVSLLKKNWQNVRSLNIKSTMGKPQRVY-
BMA10042|RPL10A      ALSINFLVSLLKKNWQNVRSLHIKSTMGPPQRLY-
STE10042|RPL10A      LLAINFLVSLLKKNWQNVRALYIKSTMGRPQRLV-
MBR10042|RPL10A      GQSVNFLVSMLKKHWQNVRSLHIKSSMGPPQRLF-
NEU10043|Rpl10a      MLAINYLVSLLKKGWQNVGSLTIKATMSPPKRLY-
GRI10042|Rpl10a      MLAINYLVSLLKKGWQNVGSLTIKATMSPPKRIY-
GRA10043|Rpl10a      MLAINYLVSLLKKGWQNVGSLTIKASMSPPKRLY-
STA10042|Rpl10a      MLAINYLVSLLKKGWQNVGSLTIKATMSPPKRLY-
YAR10043|Rpl10a      MMAANFLVSLLKKHWQNIGSLVIKSTMGPPFRLY-
POM10074|RPL10A-1    MLAVNFLVSLLKKGWQNIGSLVVKSTMGKPHRLY-
POM10075|RPL10A-2    SLAINFLVSLLKKGWQNIGSLVIKSTMGKPYRLY-
YST10073|RPL1A       LMSVNFFVSLLKKNWQNVGSLVVKSSMGPAFRLY-
YST10074|RPL1B       LMSVNFFVSLLKKNWQNVGSLVVKSSMGPAFRLY-
CIN10043|Rpl10a      MLSINFLVSLLKKNWQNVKSLHIKSTMGKPIRLY-
NEA10042|Rpl10a      MLAINFLISLLKKQWQNIQSLTIKSTMGKPQRLF-
MAY10042|Rpl10a      MLAINFLISLLKKQWQNIKSLHVKSTMGKVYRLF-
RHI10160|Rpl10a      MLSVNFLVSLLKKNWQNVKSLYLKSSMGKPHRLF-
RHI10161|Rpl10a-2    MLSVNFLVSLLKKNWQNVKSLYLKSTMGKPHRLF-
ARA10118|RPL10Ab     QMSVNFLVSLLKKNWQNVRCLYLKSTMGPPQRIF-
ARA10119|RPL10Ac     QMSVNFLVSLLKKNWQNVRCLYLKSTMGPPNRVF-
RIC10132|RPL10Ac     QMSVNFLVSLLKKNWQNVRCLYIKSTMGKPYRVF-
RIC10133|RPL10Ac     QMSVNFLVSLLKKNWQNVRCLYIKSTMGKPIRVF-
RIC10134|RPL10Ac     QMSVNFLVSLLKKNWQNVRCLYLKSTMGKVYRVF-
GMA10213|LOC10030555 QLSVNFLVSLLKKNWQNVRCLYLKSTMGKSYRVF-
GMA10214|LOC10052769 QLSVNFLVSLLKKNWQNVRCLYLKSTMGKSYRVF-
GMA10215|LOC10052776 QLSVNFLVSLLKKNWQNVRCLYLKSTMGSAIRVF-
GMA10216|LOC10080858 QLSVNFLVSLLKKNWQNVRCLYLKSTMGKSYRVF-
GMA10217|LOC10049971 QLSVNFLVSLLKKNWQNVRCLYLKSTMGKCYRVF-
POP10042|RPL10A      QMSVNFLVSLLKKNWQNVKSLHLKSTMGTPVRLY-
CRE10042|RPL10A      MYAINFLVSLLKKNWQNVRCLYIKSTMGKPIRIY-
VOL10045|RPL10A      MYAVNFLVSLLKKNWQNVRCLYIKSTMGKPIRIY-
HEM10039|rpl10A      SLAINFLVSLLKKNWQNVKSLHLKSTMGKPIKIY-
PTR10044|RPL10A      QLAANFLASLLKKQWQNIGQIYIKSTMGPPMQIYF
TPS10042|Rpl10a      QLSANFLASLLKKQWQNIGQMFIKSTMGPSIQIYF
CYA10043|RPL10A      TLAINFLISLLKKQWQNIKSIHVKTSMGKPHRLY-
DIC10042|RPL10A      IQSINFLVSLLKKGWQNIKTLYVKTSMGPSHRVY-
PLA10049|RPL10A      VHAINFLVSLLKKNWQNIRTLHIKSTMGKPQRIYG
TGO10042|RPL10A      TLAINFLVSLLKKNWNNVKTLHIKSTMGKPQQIYG
GIA10042|Rpl10a      MTTLNFLATQLKKGWQNIKTVYIKSTMGPSHRIF-