CLUSTAL W (2.1) Multiple Sequence Alignments
HAL10021|VNG1104G    -MSAEEQRTTEEVPEWKRQEVAELVDLLETYDSVGVVNVTGIPSKQLQDMRRGLH-GQAALRMSRNTLLVRALEEAGDGLDT-----LTEYVEGEVGLVA
MET10034|MJ0509      ----METKVKAHVAPWKIEEVKTLKGLIKSKPVVAIVDMMDVPAPQLQEIRDKIR-DKVKLRMSRNTLIIRALKEAAEELNNPKLAELANYVERGAAILV
PYR10058|PH1999      ---------MAHVAEWKKKEVEELAKLIKSYPVIALVDVSSMPAYPLSQMRRLIRENGGLLRVSRNTLIELAIKKAAKELGKPELEKLVEYIDRGAGILV
THE10028|TTHA0209    ----------VPNKRNVELLATLKENLERAQGSFFLVNYQGLPAKETHALRQALKQNGARLFVAKNTLIRLALKELGLPELDG-----------------
SYN10030|sll1745     ---------MGRTRENKATVISDVQELFQDAQMTVIIDYQGLTVAEITDLRNRLRPLGGTCKIAKNTLVRRALAGQEAWSPM----------------EE
BAC10029|Bsu0104     ---------MSSAIETKKVVVEEIASKLKESKSTIIVDYRGLNVSEVTELRKQLREANVESKVYKNTMTRRAVEQAELNGLN-----------------D
ECO10029|rplJ        ---------MALNLQDKQAIVAEVSEVAKGALSAVVADSRGVTVDKMTELRKAGREAGVYMRVVRNTLLRRAVEGTPFECLK-----------------D
SUL10066|ST1366      VRIMAVITQERKIAKWKIEEVKELEQKLREYHTIIIANIEGFPADKLHDIRKKMR-GMAEIKVTKNTLFGIAAKNAGLDVSKLEP-----YLTGPNAFIF


HAL10021|VNG1104G    TNDNPFGLYQQLENSKTPAPINAGEVAPNDIVVPEGDTGIDPGPFVGELQTIGANARIQEGSIQVLDDSVVTEEGETVSDDVSNVLSELGIEPKEVGLDL
MET10034|MJ0509      TDMNPFKLYKLLEENKSPAPVRGGQIAPCDIKVEKGSTGMPPGPFLGELKSVGIPAAIEKGKIAIKEDKVVVKKGEVVSPKLAAVLDRLGIKPIKVGLNI
PYR10058|PH1999      TNMNPFKLYKFLQQNRQPAPAKPGAVVPKDVVVPAGPTPLAPGPIVGQMQALGIPARIEKGKVTIQKDTTVLKAGEVITPELANILNALGIQPLEVGLDV
THE10028|TTHA0209    -LQGPSAVVFYEDPVAAAKTLVQFAK-------------------SNPKGIPQVKSGLLQGQILTAKDVEALAELPTMDELRAELVGVLQAPMAELVGVL
SYN10030|sll1745     FLTGTTAILVLKEDLGGAIKAYK--------------------KFQKDTKKTELRGGVLEGKSLTQADVEAIGDLPSKEQLMGQIAGGINALATKIALGI
BAC10029|Bsu0104     FLTGPNAIAFSTEDVVAPAKVLN--------------------DFAKNHEALEIKAGVIEGKVSTVEEVKALAELPPREGLLSMLLSVLKAPVRNLALAA
ECO10029|rplJ        AFVGPTLIAYSMEHPGAAARLFK--------------------EFAKANAKFEVKAAAFEGELIPASQIDRLATLPTYEEAIARLMATMKEASAGKLVRT
SUL10066|ST1366      TNKNPFEIQLFLSKFKLKRYAMPGDKADEEVVIPAGDTGMPAGPALSIFGKLKIKTKVQDGKIHVTQDTVIAKPGDPIPPDAIPILQKLGIMPVHIKLNI


HAL10021|VNG1104G    RGVFSEGVLFTPEELEIDVDEYRADIQSAAASARNLSVNAAYPTERTAPDLIAKGRGEAKSLGLQASVESPDLADDLVSKADAQVRALAAQIDDEDALPE
MET10034|MJ0509      LAVYEDGIIYTPDVLKVDEEKLLADIQAAYQNAFNLAFNTAYPAKEVLPFLIQKAFINARALSVETAFVTKETAGDILAKAQAQALALASKLP-DEALDE
PYR10058|PH1999      LAVYEDGIVYTPDVLAIDEQEYIDMLQKAYMHAFNLAVNIAYPTPETIEAIIQKAFLNAKTVAIEAGYITKETIQDIIGRAFRAMLLLAQQLP-EDVLDE
THE10028|TTHA0209    GGVARELVGILEAYAEKKAA--------------------------------------------------------------------------------
SYN10030|sll1745     KEVPASVARGLQAHVDKE----------------------------------------------------------------------------------
BAC10029|Bsu0104     KAVAEQKEEQGA----------------------------------------------------------------------------------------
ECO10029|rplJ        LAAVRDAKEAA-----------------------------------------------------------------------------------------
SUL10066|ST1366      KVAYDNGLIIPGNQLSINLDDYKTDIMKAYQSAFGLAVEIAYPIPDVLKVSAEKAARNALSLAAEIGFITPETVQAVFSRAISKAYALASAISGKVDLGI


HAL10021|VNG1104G    ELQDVDAPAAPAGGEADTTADEQSDETQASEADDADDSDDDDDDDDGNAGAEGLGEMFG-
MET10034|MJ0509      DIKAKLSS---VEVSAAPAAEEEKEEEKKEEEKKEEDTG-----------AAGLALLF--
PYR10058|PH1999      KTKELLSAQAQVAVATQPSEEEKKEEEKTEEEEKEEEASEEE-------ALAGLSALFG-
THE10028|TTHA0209    ------------------------------------------------------------
SYN10030|sll1745     ------------------------------------------------------------
BAC10029|Bsu0104     ------------------------------------------------------------
ECO10029|rplJ        ------------------------------------------------------------
SUL10066|ST1366      QVPQTQQAPAQQAEKKEEKKEEEEKKGPSEEEIG-----------------GGLSSLFGG