CLUSTAL W (2.1) Multiple Sequence Alignments
HUM10044|RPL11       -----------------------MAQDQGEKENPMRELRIRKLCLNICVGESGDRLTRAAKVLEQLT-------GQTPVFSKARYTVRSFGIRRNEKIAV
DOG10043|Rpl11       -----------------------MAQDQGEKENPMRELRIRKLCLNICVGESGDRLTRAAKVLEQLT-------GQTPVFSKARYTVRSFGIRRNEKIAV
MUS10043|Rpl11       -----------------------MAQDQGEKENPMRELRIRKLCLNICVGESGDRLTRAAKVLEQLT-------GQTPVFSKARYTVRSFGIRRNEKIAV
RAT10043|Rpl11       -----------------------MAQDQGEKENPMRELRIRKLCLNICVGESGDRLTRAAKVLEQLT-------GQTPVFSKARYTVRSFGIRRNEKIAV
CHK10045|Rpl11       -----------------------MAQDQGEKENPMRELRIRKLCLNICVGESGDRLTRAAKVLEQLT-------GQTPVFSKARYTVRSFGIRRNEKIAV
FUG10044|RPL11       -----------------------MADQGEKKENPMRELRIRKLCLNICVGESGDRLTRAAKVLEQLT-------GQTPVFSKARYTVRSFGIRRNEKIAV
DAN10043|Rpl11       -----------------------MADQSEKKENPMRELRIRKLCLNICVGESGDRLTRAAKVLEQLT-------GQTPVFSKARYTVRSFGIRRNEKIAV
MED10043|Rpl11       -----------------------MAEQGEKKENPMKELRIRKLCLNICVGESGDRLTRAAKVLEQLT-------GQTPVFSKARYTVRSFGIRRNEKIAV
CIO10043|RPL11       -----------------------MAEDSAKKPNCMRDIHIQKLCLNICVGESGDRLTRAAKVLEQLT-------GQTPVFSKARYTVRSFGIRRNEKIAC
DRO10061|RpL11       ------------------MAAVTKKIKRDPAKNPMRDLHIRKLCLNICVGESGDRLTRAAKVLEQLT-------GQQPVFSKARYTVRSFGIRRNEKIAV
MOS10044|Rpl11       -------------MPAKDEKTAKPAAGKDKSKNVMRDLRIRKLCLNICVGESGDRLTRAAKVLEQLT-------NQTPVYSKARYTVRSFGIRRNEKIAV
BEE10045|Rpl11       ---MADSKKSSEKKVEKRIEKKVRKEPKDASKNIMREVRIRKLCLNICVGESGDRLTRAAKVLEQLT-------GQQPVFSKARYTVRSFGIRRNEKIAV
CEL10045|rpl-11.2    ----------------MGDIEKQTEIREKKARNVMRELKIQKLCLNICVGESGDRLTRAAKVLEQLT-------GQTPVFSKARYTVRTFGIRRNEKIAV
CEL10046|rpl-11.1    ----------------MTDVEKQTEIREKKGRNVMRELKIQKLCLNICVGESGDRLTRAAKVLEQLT-------GQTPVFSKARYTVRTFGIRRNEKIAV
BMA10043|RPL11       ----------------MGKAEQLAEIREKKAANPMRELKIEKLCLNICVGESGDRLTRAAKVLEQLT-------GQTPVFSKARYTVRSFGIRRNEKIAV
STE10043|RPL11       -------------------------MAADGKMNPMKELRIRKLVLNICVGESGDRLTRAAKVLEQLT-------GQQPVFSKARYTVRSFGIRRNEKISV
MBR10043|RPL11       ---------------------MAEAEGAPAKQNPMRELRLEKLCLNLCVGESGDKLTRAAKVLEQLT-------GQQPVFSKARYTVRTFGIRRNEKIAV
NEU10044|Rpl11       ------------------------MSTEQKAQNPMRELRIQKLVLNICVGESGDRLTRAAKVLEQLS-------GQTPVYSKARYTVRTFGIRRNEKISV
GRI10043|Rpl11       -------------------------MSSEKTQNPMRELKIQKLVLNISVGESGDRLTRAAKVLEQLS-------GQTPVYSKARYTVRTFGIRRNEKIAV
GRA10044|Rpl11       -------------------------MASEKANNPMRELKIQKLVLNISVGESGDRLTRAAKVLEQLS-------GQTPVYSKARYTVRTFGIRRNEKIAV
STA10043|Rpl11       -------------------------MSDSKASNPMRELRIQKLVLNISVGESGDRLTRAAKVLEQLS-------GQTPVYSKARYTVRTFGIRRNEKIAV
YAR10044|Rpl11       --------------------------MTDSSANPMRELRIEKLTLNICVGESGDRLTRAAKVLEQLS-------GQTPVYTKARYTIRSFSIRRNEKIAV
POM10076|RPL11-1     --------------------------MAEKAQNPMKELRISKLVLNISLGESGDRLTRAAKVLEQLS-------GQTPVFSKARYTIRRFGIRRNEKIAC
POM10077|RPL11-2     --------------------------MAEKAQNPMKELRISKLVLNISLGESGDRLTRAAKVLEQLS-------GQTPVFSKARYTIRRFGIRRNEKIAC
YST10075|RPL11A      --------------------------MSAKAQNPMRDLKIEKLVLNISVGESGDRLTRASKVLEQLS-------GQTPVQSKARYTVRTFGIRRNEKIAV
YST10076|RPL11B      --------------------------MSTKAQNPMRDLKIEKLVLNISVGESGDRLTRASKVLEQLS-------GQTPVQSKARYTVRTFGIRRNEKIAV
CIN10044|Rpl11       -----------------------MADQKTTPSNPMRELRIDKLVINISVGESGDRLTRASKVLEQLT-------GQTPVTSKARYTVRTFGIRRNEKIAV
NEA10043|Rpl11       ------------------------MAEKTAAVNPMKELRIEKLVINISVGESGDRLTRAAKVLEQLT-------GQTPVTSKARYTIRSFQIRRNEKIAA
MAY10043|Rpl11       ------------------------MAESSKAINPMKELKVDKLVVNISVGESGDRLTRATKVLEQLT-------GQTPVTSKARYTLRGFGIRRNEKIAC
RHI10162|Rpl11       ----------------------MSAEEQKVTKNPMRNLRIEKLVLNISVGESGDRLTRAAKVLEQLT-------GQTPVYSKARYTVRSFSIRRNEKIAV
RHI10163|Rpl11-2     ----------------------MSAEEQKVTKNPMRNLRIEKLVLNISVGESGDRLTRAAKVLEQLT-------GQTPVYSKARYTVRSFSIRRNEKIAV
RHI10164|Rpl11-3     ----------------------MSAEEQKVTKNPMRNLRIEKLVLNISVGESGDRLTRAAKVLEQLT-------GQTPVYSKARYTVRSFSIRRNEKIAV
RHI10165|Rpl11-4     -----------------------MSTEQKTPVNPMRNLRIEKLVLNISVGESGDRLTRAAKVLEQLT-------GQTPVYSKARYTVRSFSIRRNEKIAV
RHI10166|Rpl11-5     -----------------------MSAEQKTPVNPMRNLRIEKLVLNISVGESGDRLTRAAKVLEQLT-------GQTPVYSKARYTVRSFSIRRNEKIAV
ARA10120|At2g42740   ----------------------------------MRDIKVQKLVLNISVGESGDRLTRASKVLEQLS-------GQTPVFSKARYTVRSFGIRRNEKIAC
ARA10121|RPL11B      ------------------------MASEKKLSNPMRDIKVQKLVLNISVGESGDRLTRASKVLEQLS-------GQTPVFSKARYTVRSFGIRRNEKIAC
ARA10122|RPL11C      ------------------------MASEKKLSNPMRDIKVQKLVLNISVGESGDRLTRASKVLEQLS-------GQTPVFSKARYTVRSFGIRRNEKIAC
ARA10123|RPL11D      ----------------------------------MRDIKVQKLVLNISVGESGDRLTRASKVLEQLS-------GQTPVFSKARYTVRSFGIRRNEKIAC
RIC10141|RPL11B      ------------------------MASEKKQSNPMREIKVQKLVLNISVGESGDRLTRASKVLEQLS-------GQSPVFSKARYTVRSFGIRRNEKIAC
RIC10142|RPL11B      ------------------------MASEKKQANPMREIKVQKLVLNISVGESGDRLTRASKVLEQLS-------GQSPVFSKARYTVRSFGIRRNEKIAC
GMA10218|LOC10077871 ------------------------MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRASKVLEQLS-------GQTPVFSKARYTVRSFGIRRNEKIAC
GMA10219|LOC10077871 ------------------------MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLS-------GQTPVFSKARYTVRSFGIRRNEKIAC
GMA10221|LOC10030591 ------------------------MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLS-------GQAPVFSKARYTVRSFGIRRNEKIAC
GMA10223|LOC10081008 ------------------------MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLS-------GQTPVFSKARYTVRSFGIRRNEKIAC
GMA10224|LOC10081973 ------------------------MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLS-------GQTPVFSKARYTVRSFGIRRNEKIAC
GMA10225|LOC10081841 ------------------------MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLS-------GQTPVFSKARYTVRSFGIRRNEKIAC
POP10043|RPL11-1     ------------------------MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLS-------GQTPVFSKARYTVRSFGIRRNEKIAC
POP10044|RPL11-2     ------------------------MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAKVLEQLS-------GQTPVFSKARYTVRSFGIRRNEKIAC
CRE10043|RPL11       --------------------------MAERKTRDMREIRISKLVLNIAVGESGDRLQKAAKVLEQLT-------SQVPVYGRARFTVRSFAIRRNEKISC
VOL10046|RPL11       -------------------------MADRKNTKDMREIRISKLVLNIAVGESGDRLQKAAKVLEQLT-------SQVPVYGKARFTVRSFAIRRNEKISC
PTR10045|RPL11       --------------------------MSETKTNAMREIKVDKLILNCCVGESGDRLTRAARVLEQLT-------GQQPVFSKARYTLRSFGIRRNEKIAV
TPS10043|Rpl11       -------------------------MASEGKKNPMKDIKVDKLILNCCVGESGDRLTRAARVLEQLT-------GQQPVYSKARYTLRSFGIRRNEKISV
CYA10044|RPL11       ------------------------MVNPKKLENPMRELRVDKLVINCCVGSSGDPLTKACRVLQQLTATEENPDGQAVVTSRARLTIRQFGIRRGERISA
DIC10043|RPL11       MSAKAATKNATKVAVKAPEATTPVETKKSKKDNVMRGLRIEKLVLNICVGESGDRLVRAAKVLEQLT-------GQTPVYSKARYTVRSFNIRRNEQIAA
PLA10050|RPL11       --------------------------MENKEQNVMREIKVNKLVLNICVGESGDRLTRAARVLEQLT-------EQKPIFGKCRFTIRSFGVRRNEKISC
TGO10043|RPL11       -------------------------MVKKGEENPMRKIRIEKLTLNICVGESGDRLTRAARVLEQLT-------GQRPQFSKARFTIRSFGIRRNEKIAC
GIA10043|Rpl11       --------------------------MSQESENPMRRIRIEKLVLNICIGGEGDALTKAAKVLQQLT-------DQEPTFSKSRLTIRGFGIRRGQKIST


HUM10044|RPL11       HCTVRGAKAEEILEKGLKVREYELRKNNFSDTGNFGFGIQEHIDLGIKYDPSIGIYGLDFYVVLGRPGFSIADKKRRTGCIGAKHRISKEEAMRWFQQKY
DOG10043|Rpl11       HCTVRGAKAEEILEKGLKVREYELRKNNFSDTGNFGFGIQEHIDLGIKYDPSIGIYGLDFYVVLGRPGFSIADKKRRTGCIGAKHRISKEEAMRWFQQKY
MUS10043|Rpl11       HCTVRGAKAEEILEKGLKVREYELRKNNFSDTGNFGFGIQEHIDLGIKYDPSIGIYGLDFYVVLGRPGFSIADKKRRTGCIGAKHRISKEEAMRWFQQKY
RAT10043|Rpl11       HCTVRGAKAEEILEKGLKVREYELRKNNFSDTGNFGFGIQEHIDLGIKYDPSIGIYGLDFYVVLGRPGFSIADKKRRTGCIGAKHRISKEEAMRWFQQKY
CHK10045|Rpl11       HCTVRGAKAEEILEKGLKVREYELRKNNFSDTGNFGFGIQEHIDLGIKYDPSIGIYGLDFYVVLGRPGFSIADKKRRTGNIGAKHRIGKEEAMRWFQQKY
FUG10044|RPL11       HCTVRGAKAEEILEKGLKVREYELRKNNFSDTGNFGFGIQEHIDLGIKYDPSIGIYGLDFYVVLGRPGFSITDKKRKTGRIGFRHRIRKEEAMRWFQQKY
DAN10043|Rpl11       HCTVRGAKAEEILEKGLKVREYELRKNNFSDTGNFGFGIQEHIDLGIKYDPSIGIYGLDFYVVLGRPGFSIADKKRKTGRIGAKHRIRKEEAMRWFQQKY
MED10043|Rpl11       HCTVRGAKAEEILEKGLKVREYELRKNNFSDTGNFGFGIQEHIDLGIKYDPSIGIYGLDFYVVLGRPGFSIADKKRKRGRIGFRHRIRKEEAMRWFQQKY
CIO10043|RPL11       HCTVRGPKAEEILERGLKVREYELRQGNFSKTGNFGFGIQEHIDLGIKYDPSIGIYGMDFYVMLARPGYNVRYRRKKKNRVGFPHRLTKPDGMRWFQQKY
DRO10061|RpL11       HCTVRGAKAEEILERGLKVREYELRRENFSSTGNFGFGIQEHIDLGIKYDPSIGIYGLDFYVVLGRPGYNVNHRKRKSGTVGFQHRLTKEDAMKWFQQKY
MOS10044|Rpl11       HCTVRGAKAEEILERGLKVREYELRRDNFSQTGNFGFGIQEHIDLGIKYDPTIGIYGLDFYVVLGRPGYNVAQRRRKMGKIGFIHRLTKEDAMKWFQQKY
BEE10045|Rpl11       HCTVRGAKAEEILERGLKVREYELRKENFSGTGNFGFGIQEHIDLGIKYDPSIGIYGLDFYVVLGRPGFNVAHRRRKTGKVGFQHRLTKEDAMKWFQQKY
CEL10045|rpl-11.2    HCTVRGPKAEEILEKGLKVKEYELYKENFSDTGNFGFGVQEHIDLGIKYDPSIGIYGMDFYVVLDRAGRRIAKRRRAPGRVGPSHRVEREESIKWFQQKY
CEL10046|rpl-11.1    HCTVRGPKAEEILEKGLKVKEYELFKENFSDTGNFGFGVQEHIDLGIKYDPGIGIYGMDFYVVLNRNGVRVSKRRRAPGRIGPSHRVDKEETIKWFQQKY
BMA10043|RPL11       HCTVRGPKAEEIIERGLKVKEYELYRENFSDTGNFGFGIQEHIDLGIKYDPLIGIYGMDFYVVLGRAGHRVAKRRRARGRVGHTHRVGKEEAVKWFQQKY
STE10043|RPL11       HCTVRGPKAEEILEKGLKVKEYELVKGCFSATGNFGFGIQEHIDLGIKYDPSIGIYGMDFFVVLGRPGFNISKRKHKQGRVGFPHRLTKDDAMKWFQQKY
MBR10043|RPL11       SCTVRGQKALEILERGLKVKEYELYKENFSATGNFGFGIDEHIDLGIKYDPGIGIFGMDFYVVMGRKGFRVARRKRKHSRVGAPHRIDKTDTMKWFQQQY
NEU10044|Rpl11       HVTVRGPKAEEILERGLKVKEYELRKRNFSETGNFGFGISEHIDLGIKYDPGIGIYGMDFYCCMTRPGERVSRRRRAKSRVGATHRITRDDTVKWFKSRF
GRI10043|Rpl11       HVTVRGPKAEEILERGLKVKEYELRKRNFSETGNFGFGISEHIDLGIKYDPGIGIYGMDFYCCMTRPGERVSRRRRCKSRVGTSHKINRLETMKWFKSRF
GRA10044|Rpl11       HVTVRGPKAEEILERGLKVKEYELRKRNFSETGNFGFGISEHIDLGIKYDPSIGIYGMDFYCCMTRPGERVTRRRRTKSKIGASHRIKREETVKWFKSRF
STA10043|Rpl11       HVTVRGPKAEEILERGLKVKEYELRKRNFSESGNFGFGISEHIDLGIKYDPSIGIYGMDFYVCMTRPGERVAKRRRCKSRIGASHRVNQAETVKWYKNRF
YAR10044|Rpl11       HVTVRGPKAEEILERGLKVKEYELKAKNFSETGNFGFGINEHIDLGIKYDPNIGIYGMDFFVIIGRPGYRVARRKRCRASVGINHRVTKEDTIKWFKQKY
POM10076|RPL11-1     HVTVRGPKAEEILERGLKVKEYELKKRNFSATGNFGFGIQEHIDLGIKYDPSIGIYGMDFYVVMDRPGMRVARRKAQRGRVGYTHKINAEDTINWFKQKY
POM10077|RPL11-2     HVTVRGPKAEEILERGLKVKEYELKKRNFSATGNFGFGIQEHIDLGIKYDPSIGIYGMDFYVVMDRPGMRVARRKAQRGRVGYTHKINAEDTINWFKQKY
YST10075|RPL11A      HVTVRGPKAEEILERGLKVKEYQLRDRNFSATGNFGFGIDEHIDLGIKYDPSIGIFGMDFYVVMNRPGARVTRRKRCKGTVGNSHKTTKEDTVSWFKQKY
YST10076|RPL11B      HVTVRGPKAEEILERGLKVKEYQLRDRNFSATGNFGFGIDEHIDLGIKYDPSIGIFGMDFYVVMNRPGARVTRRKRCKGTVGNSHKTTKEDTVSWFKQKY
CIN10044|Rpl11       HVTIRGPKAEEILERGLKVKEYELRRKNFSETGNFGFGIQEHIDLGARYDPTIGIFGMDFYVVMGRPGGRVAKRKAKKARIGFQHRVKRDDTMAWFKQRF
NEA10043|Rpl11       HVTIRGPKAEEVLERALKVKEYELRRRNFSQTGNFGFGIEEHIDLGIKYDPGIGIFGMDFYVVMGRPGMRVATRKHAVGKVGASHRVRPEQTVAWFKQRF
MAY10043|Rpl11       HVTIRGPKAEEIIERGLKVKEYELRRRNFSDTGNFGFGITEHIDLGIKYDPSIGIFGMDFFVCMTRAGARVARRKQRVARVGAPHRVKKEETAAWFKQRF
RHI10162|Rpl11       HVTVRGPKAEEILERGLKVKEYELKARNFSETGNFGFGIDEHIDLGIKYDPSIGIYGMDYYVVMGRPGYRVSRRKHCKSTVGVTHRIKKEESIEWFKNRF
RHI10163|Rpl11-2     HVTVRGPKAEEILERGLKVKEYELKARNFSETGNFGFGIDEHIDLGIKYDPSIGIYGMDYYVVMGRPGYRVSRRKHCKSTVGVTHRIKKEESIEWFKNRF
RHI10164|Rpl11-3     HVTVRGPKAEEILERGLKVKEYELKARNFSETGNFGFGIDEHIDLGIKYDPSIGIYGMDYYVVMGRPGYRVSRRKHCKSTVGVTHRIKKEESIEWFKNRF
RHI10165|Rpl11-4     HVTVRGPKAEEILERGLKVKEYELKARNFSETGNFGFGIDEHIDLGIKYDPSIGIYGMDYYVVMGRPGYRVSRRKHCKSTVGVTHRIKKEESIEWFKNRF
RHI10166|Rpl11-5     HVTVRGPKAEEILERGLKVKEYELKARNFSETGNFGFGIDEHIDLGIKYDPSIGIYGMDYYVVMGRPGYRVSRRKHCKSTVGVTHRIKKEESIEWFKNRF
ARA10120|At2g42740   YVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFYVVLERPGYRVARRRRCKARVGIQHRVTKDDAMKWFQVKY
ARA10121|RPL11B      YVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFYVVLERPGYRVARRRRCKTRVGIQHRVTKDDAMKWFQVKY
ARA10122|RPL11C      YVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFYVVLERPGYRVARRRRCKTRVGIQHRVTKDDAMKWFQVKY
ARA10123|RPL11D      YVTVRGEKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFYVVLERPGYRVARRRRCKTRVGIQHRVTKDDAMKWFQVKY
RIC10141|RPL11B      YVTVRGEKAMQLLESGLKVKEYELLRRNFSETGCFGFGIQEHIDLGIKYDPSTGIYGMDFYVVLERAGYRVARRRRCKSRVGIQHRVTKEDAMKWFQVKY
RIC10142|RPL11B      YVTVRGEKAMQLLESGLKVKEYELLRRNFSETGCFGFGIQEHIDLGIKYDPSTGIYGMDFYVVLERAGYRVARRRRCKSRVGIQHRVTKEDAMKWFQVKY
GMA10218|LOC10077871 YVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFFVVLERPGYRVGRRRRCKSRVGIQHRVTKEDAMKWFQVKY
GMA10219|LOC10077871 YVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFFVVLERPGYRVGRRRRCKSRVGIQHRVTKEDAMKWFQVKY
GMA10221|LOC10030591 YVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFFVVLERPGYRVGRRRRCKSRVGIQHRVTKEDAMKWFQVKY
GMA10223|LOC10081008 YVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFFVVLERPGYRVGRRRRCKSRVGIQHRVTKEDAMKWFQVKY
GMA10224|LOC10081973 YVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFFVVLERPGYRVGRRRRCKSRVGIQHRVTKEDAMKWFQVKY
GMA10225|LOC10081841 YVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFFVVLERPGYRVGRRRRCKSRVGIQHRVTKEDAMKWFQVKY
POP10043|RPL11-1     YVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFYVVLERPGYRVGRRRRCKSRVGIHQRVTKDDAMKWFQVKY
POP10044|RPL11-2     YVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQEHIDLGIKYDPSTGIYGMDFYVVLERPGYRVGRRRRCKSRVGIHQRVTKDDAMKWFQVKY
CRE10043|RPL11       YVTVRGEKAYDLVKRGLAVKEFELIRKNFSDTGNFGFGIQEHIDLGLKYDPSTGIYGMDFYVCLERRGYRVARRRKQKAHVGVKHKVTKEDAIKWFQQEF
VOL10046|RPL11       FVTVRGEKAYDLVKRGLAVKEFELLRKNFSDTGNFGFGIQEHIDLGLKYDPSTGIYGMDFYVCLERRGYRVARRRKCKSRVGVKHKVTKEDAIKWFQQEF
PTR10045|RPL11       HVTVRGEKALEILERGLKVKEYELLQKNFSDTGNFGFGINEHIDLGIKYDPTTGIYGMDFFVCLTRPGARVARRKIRQGRIGFNHKITKEDSIKWFQDKF
TPS10043|Rpl11       HVTVRGEKALEILERGLKVKEYELLQQNFSETGNFGFGINEHIDLGIKYDPTTGIYGMDFFVCLTRPGARVARRKVRQSRVGFAHKIKKEEAIQWFQDKF
CYA10044|RPL11       HVTIRGQKALDLLERGLRVREYELHESNFSDTGCFGFGIQEHIDLGLKYDPATGIFGMDFVVVLKRRGARVARRRRCRSTVGPLQRVSKEDAIRFFQAQY
DIC10043|RPL11       HVTVRGEKAAEILEKGLKVREFELRARNFSTQGSFGFGIQEHIDLGIKYDPSIGIYGMDFFVVLSRPGFRVAHKKRAGAKVGFQHKIGKEDAVNWFKTTY
PLA10050|RPL11       FVTVRGKKALEILEKGLKVKEYELRRKNFSDTGNFGFGIQEHIDLGIKYDPSTGIYGMDFYVHLSRSGYRVTRRTRRRSKISKTHKVTKEDAMKWFQTKF
TGO10043|RPL11       YVTVRGKKAEDILEKGLKVKEYELKKKNFSDSGNFGFGIQEHIDLGIKYDPSTGIYGMDFYVQLTRPGNRVAHRKRARGRVGHSHRVTKEDSIKWFQQTY
GIA10043|Rpl11       HVTVRGEKAREIIERGLRVKNFELPYSCFSTTGNFGFGITEHIDLGIKYDPSMGIYGMDFYVVLSRPGFRVNKRRAQQQHVGASHKITPDEARAWVEREF


HUM10044|RPL11       DGIILPGK----------------
DOG10043|Rpl11       DGIILPGK----------------
MUS10043|Rpl11       DGIILPGK----------------
RAT10043|Rpl11       DGIILPGK----------------
CHK10045|Rpl11       DGIILPGK----------------
FUG10044|RPL11       DGIILPGK----------------
DAN10043|Rpl11       DGIILPGK----------------
MED10043|Rpl11       DGIILPGK----------------
CIO10043|RPL11       DGILLPGK----------------
DRO10061|RpL11       DGIILNTKK---------------
MOS10044|Rpl11       DGVILNSKAK--------------
BEE10045|Rpl11       DGIIIAGKK---------------
CEL10045|rpl-11.2    DGIILPPKPKVKRTFHRRR-----
CEL10046|rpl-11.1    DGIILPPKPKVKKNFFRRR-----
BMA10043|RPL11       DGIILPPKAKEIRRGRRH------
STE10043|RPL11       DGVLLNK-----------------
MBR10043|RPL11       DGVLMTGKPVNRSVNRPIKKKKKK
NEU10044|Rpl11       DAIVR-------------------
GRI10043|Rpl11       DGIVR-------------------
GRA10044|Rpl11       DGIVR-------------------
STA10043|Rpl11       EGIVR-------------------
YAR10044|Rpl11       DASVL-------------------
POM10076|RPL11-1     DAVVLGK-----------------
POM10077|RPL11-2     DAVVLGK-----------------
YST10075|RPL11A      DADVLDK-----------------
YST10076|RPL11B      DADVLDK-----------------
CIN10044|Rpl11       DGIILK------------------
NEA10043|Rpl11       DGIVSR------------------
MAY10043|Rpl11       DGIIMR------------------
RHI10162|Rpl11       DGVVSNKA----------------
RHI10163|Rpl11-2     DGVVSNKN----------------
RHI10164|Rpl11-3     DGVVSNKN----------------
RHI10165|Rpl11-4     DGVVSNKA----------------
RHI10166|Rpl11-5     DGVVSNKA----------------
ARA10120|At2g42740   EGVILNKSQNITG-----------
ARA10121|RPL11B      EGVILNKSQNITG-----------
ARA10122|RPL11C      EGVILNKSQNITG-----------
ARA10123|RPL11D      EGVILNKSQNITG-----------
RIC10141|RPL11B      EGVILNKAQANTS-----------
RIC10142|RPL11B      EGVILNKAQANTS-----------
GMA10218|LOC10077871 EGVILNKSQAIL------------
GMA10219|LOC10077871 EGVILNKSQAIV------------
GMA10221|LOC10030591 EGVILNKSQAIV------------
GMA10223|LOC10081008 EGVILNKSQAIV------------
GMA10224|LOC10081973 EGVILNKSQAIV------------
GMA10225|LOC10081841 EGVILNKSQAIF------------
POP10043|RPL11-1     EGVILNKSQNI-------------
POP10044|RPL11-2     EGVILNKSQNI-------------
CRE10043|RPL11       DGVVLNKAPAS-------------
VOL10046|RPL11       DGVVLNKAPTA-------------
PTR10045|RPL11       EGVVLAKEA---------------
TPS10043|Rpl11       EGVVLAKAT---------------
CYA10044|RPL11       DGIVHR------------------
DIC10043|RPL11       DGIVIGGKK---------------
PLA10050|RPL11       DGILLK------------------
TGO10043|RPL11       DGIVLNH-----------------
GIA10043|Rpl11       EVVYTK------------------