CLUSTAL W (2.1) Multiple Sequence Alignments
HAL10022|VNG1108G    ----MAETIEVLVAGGQADPGPPLGPELGPTPVDVQAVVQEINDQTEAFDGTEVPVTIEYE-DDGSFSIEVGVPPTAALVKDEAGFDTGSGEPQENFVAD
MET10035|MJ0373      ---MAKEVVEVLVTGGRATAGPPLGPAIGPLGVNVMQVVKEINEKTKDYEGMQVPVKVIVDTETRKFEIEVGIPPTTALIKKELGIETAAHEPRHEVVGN
PYR10021|PH0001      ---MKKQVVEVLVEGGKATPGPPLGPAIGPLGLNVKQVVDKINEATKEFAGMQVPVKIIVDPVTKQFEIEVGVPPTSQLIKKELGLEKGSGEPKHNIVGN
THE10029|TTHA0247    -MKKVVAVVKLQLPAGKATPAPPVGPALGQHGANIMEFVKAFNAATANMGD-AIVPVEITIYADRSFTFVTKTPPASYLIRKAAGLEKGAHKPGREKVGR
SYN10031|sll1743     MAKKVVALIKLALPAGKANPAPPVGPALGQHGVNIMAFCKEYNAKTADKPG-MIIPVEISVFEDRSFTFILKTPPASVLIRKAAGVEKGSSEPNKNKVAS
BAC10030|Bsu0102     VAKKVVKVVKLQIPAGKANPAPPVGPALGQAGVNVMGFCKEFNARTADQAG-LIIPVEISVYEDRSFTFITKTPPAAVLLKKAAGIESGSGEPNRNKVAT
ECO10030|rplK        MAKKVQAYVKLQVAAGMANPSPPVGPALGQQGVNIMEFCKAFNAKTDSIEKGLPIPVVITVYADRSFTFVTKTPPAAVLLKKAAGIKSGSGKPNKDKVGK
SUL10023|ST1368      ---MPTKSIKIVVEGGNVKPGPPLAPTLSQLGLNVGEVVKKINDATSQFKGMSVPVTLEVDTDTKKYEIKVGIPTTTSLLLKFANASEPSGDPAHKKVGD


HAL10022|VNG1108G    LSIEQLKTIAEQKKPDLLAYDARNAAKEVAGTCASLGVTIEGEDARTFNERVDDGDYDDVLGDELAAA-----
MET10035|MJ0373      LTLEQVIKIAKMKKDAMLSYTLKNAVKEVLGTCGSMGVTVEGKDPKEVQKEIDAGVYDEYFKEE---------
PYR10021|PH0001      LTMEQVIKIAKMKRSQMLALTLKAAAKEVIGTALSMGVTVEGKDPRIVQREIDEGVYDELFEKAEKE------
THE10029|TTHA0247    ITWEQVLEIAKQKMPDLNTTDLEAAARMIAGSARSMGVEVVGAPEVKDA------------------------
SYN10031|sll1743     ITREQLREIAQTKLPDLNANDIDAAMNIIEGTARNMGITVNS-------------------------------
BAC10030|Bsu0102     VKRDKVREIAETKMPDLNAADVEAAMRMVEGTARSMGIVIED-------------------------------
ECO10030|rplK        ISRAQLQEIAQTKAADMTGADIEAMTRSIEGTARSMGLVVED-------------------------------
SUL10023|ST1368      IKFEDIIQVAIMKKPQITAKTLKAAVKSILGTAHSIGLTVDKKSPKELVKAVDEGKYDDLLAKYEQKWNEAEG