CLUSTAL W (2.1) Multiple Sequence Alignments
HUM10045|RPL12       MPPKFDPNEIKVVYLRCTGGEVGATSALAPKIGPLGLSPKKVGDDIAKAT-GDWKGLRITVKLTIQNRQAQIEVVPSASALIIKALKEPPRDRKKQKNIK
DOG10044|Rpl12       MPPKFDPNEIKVVYLRCTGGEVGATSALAPKIGPLGLSPKKVGDDIAKAT-GDWKGLRITVKLTIQNRQAQIEVVPSASALIIKALKEPPRDRKKQKNIK
MUS10044|Rpl12       MPPKFDPNEVKVVYLRCTGGEVGATSALAPKIGPLGLSPKKVGDDIAKAT-GDWKGLRITVKLTIQNRQAQIEVVPSASALIIKALKEPPRDRKKQKNIK
RAT10044|Rpl12       MPPKFDPNEIKVVYLRCTGGEVGATSALAPKIGPLGLSPKKVGDDIAKAT-GDWKGLRITVKLTIQNRQAQIEVVPSASALIIKALKEPPRDRKKQKNIK
CHK10046|Rpl12       MPPKFDPTEVKVVYLRCTGGEVGATSALAPKIGPLGLSPKKVGDDIAKAT-GDWKGLRITVKLTIQNRQAQIEVVPSASALIIKALKEPPRDRKKQKNIK
FUG10045|RPL12       MPPKFDPNEVKIVFMRCTGGEVGATSALAPKIGPLGLSPKKVGDDIAKAT-GDWKGLRITVKLTIQNRQAAIEVVPSASALIIKALKEPPRDRKKVKNVK
DAN10044|Rpl12       MPPKFDPNEIKVVFMRCTGGEVGATSSLAPKIGPLGLSPKKVGDDIAKAT-GDWKGLRITVKLTIQNRQAAIEVVPSASALIIKALKEPPRDRKKVKNIK
MED10044|Rpl12       MPPKFDPNEIKIVYMRCTGGEVGATSALAPKIGPLGLSPKKVGDDIAKAT-GDWKGLRITVKLTIQNRQAAIEVVPSASALIIKALKEPPRDRKKVKNIK
CIO10044|RPL12       MPPKFDPTAIHYVYLRVTGGEVGATASLAPKIGPLGLSPKKVGDDIAKST-QDWKGLKITVCLKIQNRQATVSVVPSAASLVIKALKEPPRDKKKVKNIK
DRO10062|RpL12       MPPKFDPTEVKLVYLRCVGGEVGATSSLAPKIGPLGLSPKKIGDDIAKAT-SDWKGLKITVCLTIQNRQAAISVVPSAASLIIKALKEPPRDRKKQKNIK
MOS10045|Rpl12       MPPKFDPNEVKHVYLRCVGGEVGATSSLAPKIGPLGLSPKKIGDDIAKAT-GDWKGLKITVCLTIQNRQAAISVVPSAASLIVKALKEPPRDRKKVKNIK
BEE10046|Rpl12       MPPKFDPNEIKKVYLRCVGGEVGATSSLAPKIGPLGLSPKKVGDDIAKAT-SDWKGLKITVQLTIQNRQATISVVPSAASLIIKSLKEPPRDRKRQKNIK
CEL10047|rpl-12      MPPKFDPTEIKIVYLRCVGGEVGATSALAPKVGPLGLSPKKIGEDIAKAT-QDWKGLKVTCKLTIQNRVAKIDVVPSAASLIVKELKEPPRDRKKVKNVK
BMA10044|RPL12       MPPKFDPSEIKIVYLRCVGGEVGATSALAPKVGPLGLSPKKIGDDIAKAT-QDWKGLKVTCKLTIQNRVAKIDVVPSAASLLIKELKEPARDRKKVKNVK
STE10044|RPL12       MPPKFDPNEIQYVYLRCTGGEVGATASLAPKIGPLGLSPKKVGDDIAKAT-QDWKGLKITVCLTIQNRQAKVSVVPSASSLIIKALKEPPRDRKKVKNIK
MBR10044|RPL12       MAPKFDPNAIDYVYLRAVGGEVGATSALAPKIGPLGLSPKKVGDDIAKGT-KDWKGLRVTVKLTIQNRKATVSVVPSASSLVIAALKEPVRDRKKEKNVA
NEU10045|Rpl12       MPPKFDPNEVKVITLRATGGEVGASSALAPKIGPLGLSPKKVGEDIAKAT-GDWKGLRVTVKLTIQNRQAAVSVVPTASALVIRALKEPPRDRKKEKNIK
GRI10044|Rpl12       MPPKFDPNEVKVIHLRATGGEVGASSALAPKIGPLGLSPKKVGEDIAKAT-GDWKGLRVTVKLTIQNRQAAVSVVPTASSLIIRALKEPPRDRKKEKNIK
GRA10045|Rpl12       MPPKFDPNEVKVIHLRATGGEVGASSALAPKIGPLGLSPKKVGEDIAKAT-GDWKGLRVTVKLTIQNRQAAVSVVPTASSLIIKALKEPPRDRKKEKNIK
STA10044|Rpl12       MPPKFDPSEVKVIHLRATGGEVGASSALAPKIGPLGLSPKKVGEDIAKAT-GDWKGLRVTVKLTIQNRQAAVSVVPSASSLVIKALKEPPRDRKKEKNIK
YAR10045|Rpl12       MPPKFDPNEVKIIYLRAMGGEVGASSALAPKIGPLGLSPKKIGEDIAKAT-KAHKGVRVTVQLTIQNRQATVSVVPSASSLVIAALKEPPRDRKKDKNVK
POM10078|RPL12-1     MPPKFDPNEVKTIFMRAVGGEVAGGSTLAPKIGPLGLSPKKVGEDIAKAT-KDWKGLRVTVKLTIQNRQAAVSVVPSASALVIKALKEPARDRKKDKNVA
POM10079|RPL12-2     MPPKFDPNEVKTIFMRAVGGEVAGGSTLAPKIGPLGLSPKKVGEDIAKAT-KDWKGLRVTVKLTIQNRQAAVSVVPSASALVIKALKEPARDRKKDKNVA
YST10077|RPL12A      MPPKFDPNEVKYLYLRAVGGEVGASAALAPKIGPLGLSPKKVGEDIAKAT-KEFKGIKVTVQLKIQNRQAAASVVPSASSLVITALKEPPRDRKKDKNVK
YST10078|RPL12B      MPPKFDPNEVKYLYLRAVGGEVGASAALAPKIGPLGLSPKKVGEDIAKAT-KEFKGIKVTVQLKIQNRQAAASVVPSASSLVITALKEPPRDRKKDKNVK
CIN10045|Rpl12       MAPKFDPNEVKIIYLRATGGEVGASSALAPKIGPLGLSPKKIGEDIAKAT-SQWKGLRVTVQLTIQNRQATVSVVPSASSLVIKALKEPPRDRKKEKNIK
NEA10044|Rpl12       MPPKFDPSEVKIIYLRATGGEVGASSALAPKIGPLGLSPKKVGEDIAKAT-GDWKGLRVTVQLTIQNRQAAVSVVPSASSLVIKALKEPPRDRKKEKNIK
MAY10044|Rpl12       MAPKIDPNEIKIIYLRATGGEVGASSALAPKIGPLGLSPKKVGEDIAKAT-GDWKGLRVTVQLTVQNRQAAVSVVPSASSLVIKALKEPPRDRKKEKNIK
RHI10167|Rpl12       MPPKFDPSEVKIIYLRATGGEVGASSALAPKIGPLGLSPKKVGEDIAKGT-KDWKGLRVTVQLTIQNRQAQVSVVPSASSLVIKALKEPLRDRKKEKNIK
RHI10168|Rpl12-2     MPPKFDPSEVKIIYLRATGGEVGASSALAPKIGPLGLSPKKVGEDIAKGT-KDWKGLRVTVQLTIQNRQAQVSVVPSASSLVIKALKEPLRDRKKEKNIK
RHI10169|Rpl12-3     MPPKFDPSEVKIIYLRATGGEVGASSALAPKIGPLGLSPKKVGEDIAKGT-KDWKGLRVTVQLTIQNRQAQVSVVPSASSLVIKALKEPLRDRKKEKNIK
RHI10170|Rpl12-4     MPPKFDPSEVKIIYLRATGGEVGASSALAPKIGPLGLSPKKVGEDIAKGT-KDWKGLRVTVQLTIQNRQAQVSVVPSASSLVIKALKEPLRDRKKEKNIK
RHI10171|Rpl12-5     MPPKFDPSEVKIIYLRATGGEVGASSALAPKIGPLGLSPKKVGEDIAKGT-KDWKGLRVTVQLTIQNRQAQVSVVPSASSLVIKALKEPLRDRKKEKNIK
ARA10124|RPL12A      MPPKLDPSQIVDVYVRVTGGEVGAASSLAPKIGPLGLAPKKIGEDIAKETAKEWKGLRVTVKLTVQNRQAKVTVVPSAAALVIKALKEPERDRKKVKNIK
ARA10125|RPL12B      MPPKLDPSQIVDVYVRVTGGEVGAASSLAPKIGPLGLAPKKIGEDIAKETAKEWKGLRVTVKLTVQNRQAKVTVVPSAAALVIKALKEPERDRKKVKNIK
ARA10126|RPL12C      MPPKLDPSQIVDVYVRVTGGEVGAASSLAPKIGPLGLAPKKIGEDIAKETAKEWKGLRVTVKLTVQNRQAKVTVVPSAAALVIKALKEPERDRKKVKNIK
RIC10148|RPL12A      MPPKLDPTQVVDVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVTVKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKVKNIK
RIC10149|RPL12B      MPPKLDPTQVVDVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVTVKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKVKNIK
GMA10227|LOC10052786 MPPKFDPSQIVDVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVTVKLTVQNRQAKVTVVPSAAALVIKALKEPERDRKKTKNIK
GMA10228|LOC10081165 MPPKFDPSQIVDVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVTVKLTVQNRQAKVTVVPSAAALVIKALKEPERDRKKTKNIK
GMA10229|LOC10078956 MPPKFDPSQVVDVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVTVKLTVQNRQAKVTVVPSAAALVIKALKEPERDRKKTKNIK
GMA10230|LOC10079231 MPPKFDPSQVVDVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVTVKLTVQNRQAKVTVVPSAAALVIKALKEPERDRKKTKNIK
POP10045|RPL12       MPPKFDPSQVVDVYVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVTVKLTVQNRQAKVTVVPSAAALVIKALKEPERDRKKTKNIK
CRE10044|RPL12       MPPKFDPSDVVEVCVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETLKDWKGLRITVKLTVQNRQAKISVIPSAAALVIKALKEPARDRKKEKNIK
VOL10047|RPL12       MPPKFDPNDVVEVCVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRITVKLTVQNRQAKISVIPSAAALVIKALKEPPRDRKKEKNIK
HEM10041|rpl12       MAPKFDPNSITIIFIRTVGGEVGAVSSLAPKIGPLGLSPKKIGEQLSSST-KDWEGLRVTCKLKVQNRQTEVEVVPSAAVLLIKGLKEPKRDRKKTKNIK
PTR10046|RPL12       -MGPPPSDDVKIVIMRTVGGEIGSASSLAPKIGPLGLSPKKVGEDIQKAT-MDWKGLNVTVKLTVVNRQATVSMIPSSSSLVMKALNEPVRDRKKVKNVK
TPS10044|Rpl12       -MGGPPSDDVKIVIMRTVGGEVGSASSLAPKIGPLGLSPKKVGEDIQKAT-MDWKGLNVTVKLTVVNRQATVSMIPSASSLVMKALNEPVRDRKKVKNVV
CYA10045|RPL12       MPPKGDPNAVTIVYVRVVGGEGAAASSLAPKIGPLGLSPKKVGDDIAKAT-KDWKGLRIMVKLTVQNRQAQVEVVPSAAALIIRALKEPPRDRKKVKNVK
DIC10044|RPL12       MPPKVDPSEKVEVFLRVCGGEAGAMSTLAPKLGPLGVSPKKVGDDIAKAT-QPWKGMKVSVKLTIQNRIAVPEVLPSASALVIKALKEPPRDRKKEKNIK
PLA10051|RPL12       MAKKPDPNEIKYVFIRQVGGEVGASSVLSPKLGPLGLSPKKVGDDIAKET-QSWKGLKICVKLTIQNRQAKVEVVPTSAALILKELNEAPRDRKKVKNIK
TGO10044|RPL12       MAPKFDPSEVKYIYLRQVGGEVGASSVLAPKLGPLGMSPKKVGDDIAKAT-VAWKGLKVTVKLAVQNRQATVEVVPSASSLIIKELKEPPRDRKKVKNIK
GIA10044|Rpl12       MPPRADPNAEIVLYLRVKGGIIPAPNALGPKIGPYGLPPKVVGEKIHEAT-QGYKGIRVKVRIVSKNRQPTVSVVPTASSLLVKALGEGPRTIPKGQPLL


HUM10045|RPL12       HSGNITFDEIVNIARQMRHRSLARELSGTIKEILGTAQSVGCNVDGR----HPHDIIDDINSGAVECPAS-------------
DOG10044|Rpl12       HSGNITFDEIVNIARQMRHRSLARELSGTIKEILGTAQSVGCNVDGR----HPHDIIDDINSGAVECPAS-------------
MUS10044|Rpl12       HSGNITFDEIVNIARQMRHRSLARELSGTIKEILGTAQSVGCNVDGR----HPHDIIDDINSGAVECPAS-------------
RAT10044|Rpl12       HNGNITFDEIVNIARQMRHRSLARELSGTIKEILGTAQSVGCNVDGR----HPHDIIDDINSGAVECPAS-------------
CHK10046|Rpl12       HSGSVSFDEIVNIARQMRHRSLARELSGTIKEILGTAQSVGCSIDGR----HPHDIIDDINSGAIECPAS-------------
FUG10045|RPL12       HSGSVPFDEIVNIARLMRHRSIARELSGTIKEILGTAQSVGCTIDGR----PPHDVIDDINSGKVECPTE-------------
DAN10044|Rpl12       HSGSVAFDEIVNIARVMRHRSIARELSGTIKEILGTAQSVGCTIDGR----LPHDVIDDINSGAVECPTE-------------
MED10044|Rpl12       HSGSVTFDEIVGIARVMRHRSIARELSGTIKEILGTAQSVGCTIDGR----HPHDVIDDINSGKVECPSD-------------
CIO10044|RPL12       HNGNITMEDVYGVARIMRERSMSRFFSGTVKEILGTAQSVGCTVDGK----PPHDVIDMINDGEIECPDE-------------
DRO10062|RpL12       HSGNIGFEDILAIARVMRPRSMARELKGTCKEVLGTAQSVGCTVDGK----HPHDVIDELNEGSIEVPAE-------------
MOS10045|Rpl12       HNGNITFDEVINIARVMRPRSMARELAGTCKEVLGTAQSVGCTIDGR----SPHDVIDDISSGAIEIPSE-------------
BEE10046|Rpl12       HNGNLSFDDIVSIARSMRPRSMSKYLSGTVKEILGTCQSVGCTVEGR----PPRDLIEEINGGKLQVPDE-------------
CEL10047|rpl-12      HNGDLTVDTIIKIARIMRPRSMAKKLEGTVKEILGTAQSVGCTIDGQ----HPHDIIESIANGEIEIPAQ-------------
BMA10044|RPL12       HNGDLTVEQVINIARQMRPRSMAKKLEGTVKEILGTAQSVGCTVNGQ----HPHDIVDAIRSGDIVIPED-------------
STE10044|RPL12       HNGNITLDDVTNVAKVMRPRSMARHLSGTVKEILGTCQSVGCTVDGM----APHDVIDKINSGEIEIEDSD------------
MBR10044|RPL12       HNGNISYNDVYGIAKTMRGRSMARAMSGTVKEILGTCQSVGCTVDGK----HPHTLIEEIDNGDLVVEDFEAPKAE-------
NEU10045|Rpl12       HNKSVSFDEIVEIARTMRFKSFSKELKGTVLEVLGTAFSVGCQVDGK----SPKAVQEAIHAGEIDVPEE-------------
GRI10044|Rpl12       HNKSVALDEIIEIARTMKFKSFSKDLAGVVKEILGTAYSVGCQVDGK----SPREITDAINAGEIDIPEE-------------
GRA10045|Rpl12       HNKSVALDEIIEIARTMRYKSFAKDLSGTVKEILGTAYSVGCQVDGK----PPQSVIEAIDSGDIDIPEE-------------
STA10044|Rpl12       HTKSIPLDEIISIARTMRFKSMAKDLKGTVKEILGTAFSTGCQVDGR----SPKDISDDIESGEIEIPEE-------------
YAR10045|Rpl12       HNGNIPLEEIIEIARTMRSKSFSKELSGTVKEILGTAQSVGARVNGK----PAHVMIDAINNGEQDIPDN-------------
POM10078|RPL12-1     HSGNVSLDEIIEVARTMRFKSLAKELSGTVKEILGTAFSVGCTVDGK----NPHDVQKEIDNGEIEIPQE-------------
POM10079|RPL12-2     HSGNVSLDEIIEVARTMRFKSLAKELSGTVKEILGTAFSVGCTVDGK----NPHDVQKEIDNGEIEIPQE-------------
YST10077|RPL12A      HSGNIQLDEIIEIARQMRDKSFGRTLASVTKEILGTAQSVGCRVDFK----NPHDIIEGINAGEIEIPEN-------------
YST10078|RPL12B      HSGNIQLDEIIEIARQMRDKSFGRTLASVTKEILGTAQSVGCRVDFK----NPHDIIEGINAGEIEIPEN-------------
CIN10045|Rpl12       HSGNIPLEEIIDIARQMRSKSLAKELSGTVKEILGTAQSVGCTVNGQ----PAHDVIDGINSGEIEIPDE-------------
NEA10044|Rpl12       HSGNIPLDQIYDIARKMAHKSFAKNLSGGVREILGTAHSVGCTVDGK----SPHDIIVAIQEGEIVVPDE-------------
MAY10044|Rpl12       HGGNIPLDEIVEIARKMRFKSFAKSLSGTVKEILGTAQSVGCTVNGQ----NPHAIIEGIDAGEIEIDDE-------------
RHI10167|Rpl12       HSGNISLDDVIEIARTMRFKSLARELKGTVKEILGTAFSVGCTVEGQ----NPKDLCDAIDAGEVEIPEK-------------
RHI10168|Rpl12-2     HSGNISLDDVIEIARTMRFKSLARELKGTVKEILGTAFSVGCTVEGQ----NPKDLCDAIDAGEVEIPEK-------------
RHI10169|Rpl12-3     HSGNISLDDVIEIARTMRFKSMARELKGTVKEILGTAFSVGCTVEGQ----NPKDLCDAIDAGEVEIPEK-------------
RHI10170|Rpl12-4     HSGNISLDDVIEIARTMRFKSLARELKGTVKEILGTAFSVGCTVEGQ----NPKDLCDAIDAGEVEIPEK-------------
RHI10171|Rpl12-5     HSGNISLDDVIEIARTMRFKSLARELKGTVKEILGTAFSVGCTVEGQ----NPKDLCDAIDAGEVEIPEK-------------
ARA10124|RPL12A      HNGNISFDDVTEIARIMRPRSIAKELSGTVREILGTCVSVGCTVDGK----DPKDIQQEIQDGEVEIPEN-------------
ARA10125|RPL12B      HNGNISFDDVTEIARIMRPRSIAKELSGTVREILGTCVSVGCTVDGK----DPKDLQQEIQEGEIEIPEN-------------
ARA10126|RPL12C      HNGNISFDDVIEIAKIMRPRSIAKELSGTVKEILGTCVSVGCTVDGK----DPKDLQEEINSGDIDIPNE-------------
RIC10148|RPL12A      HSGNISLDDVIEIARVMRPRSMAKEMAGTVKEILGTCVSVGCTVDGK----DPKDLQQEISDGEVEIPSA-------------
RIC10149|RPL12B      HSGNISLDDVIEIARIMRNRSMAKEMAGTVKEILGTCVSVGCTVDGK----DPKDLQQEISDGEVEIPSA-------------
GMA10227|LOC10052786 HNGNISLDDVIEIARVMRPRSMAKDLSGSIKEILGTCVSVGCTVDGK----DPKDLQQEISDGDVEVPLD-------------
GMA10228|LOC10081165 HNGNISLDDVIEIARVMRPRSMAKDLSGSIKEILGTCVSVGCTVDGK----DPKDLQQEITDGDVEVPLD-------------
GMA10229|LOC10078956 HNGNISLDDVVEIARVMSPRSMAKDLSGTIKEILGTCVSVGCTVDGK----DPKDLQQEISDGDVEVPLH-------------
GMA10230|LOC10079231 HSGNISLDDVVEIARVMSPRSMAKDLSGTIKEILGTCVSVGCTVDGK----DPKDLQQEISDGDVEVPLE-------------
POP10045|RPL12       HNGNISLDDVIEIAKVMSVRSMAKDLSGTVKEILGTCVSVGCTVDGK----DPKDLQQEITDGDVEISE--------------
CRE10044|RPL12       HTGSVTMSDIIEIARVMRPRSCAKDLANGCKEILGTAVSVGCKVDGK----DPRDVISAIDDGAIEIPDA-------------
VOL10047|RPL12       HSGSVTMSDIIEIARVMRPRSCAKDLANGCKEILGTAVSVGCKVDGK----DPRDVIAAINDGSLEVPDA-------------
HEM10041|rpl12       HNGTLTLAYIVKIAKILKSRSFSTNLRGGVREILGTAKAIGCLIEKN----SPSKFM--------------------------
PTR10046|RPL12       HDGNLTLDQIIDIARQMRERSMARKLKGTVKEILGTANSIGCSVNGE----SPRDIQASIDDGEIEIPEE-------------
TPS10044|Rpl12       HNGNITLDQVIDIARQMRERSMAKKLAGTVKEILGTANSIGCTVNGE----SPRDIQAGIDDGEVEIPEE-------------
CYA10045|RPL12       HDGNLTLDEIKEIARIMRERSCARELSGVVREILGTCHSIGCMVEGR----HPREVIEQIRSGEIMIENV-------------
DIC10044|RPL12       HNGNIPLEEICKIAKTMRFKSLAVDFKGSVLEILGTAHSVGCKVNGK----SPRDIQAGIQSGEIEVVEPK------------
PLA10051|RPL12       HNGNLKLEQVYSIARVMKEKSRAKEFKGTVKEMLGTCNSIGCTVDGK----KPTTIQEMIDSGEIDVPLE-------------
TGO10044|RPL12       HSGNLSLDQVFSIARTMRAKSQAWEFSGTVKEILGTCNSVGCTVDGK----SPKQVQRMLDDGEIDCPEA-------------
GIA10044|Rpl12       HTGTVKFDTVLDIAKELRANSFALKYAGTVLEVLGSARSVGCKVEYKGTVYSPAEITEMVKAGDIEIPEYNVPYQLAEEQETE