CLUSTAL W (2.1) Multiple Sequence Alignments
HUM10047|RPL13A      -----MAEVQVLVLDGRGHLLGRLAAIVAKQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNPSRG-PYHFRAPSRIFWRTVRGMLPHKTKR
DOG10046|Rpl13a      -----MAEGQVLVLDGRGHLLGRLAAIVAKQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNPSRG-PYHFRAPSRIFWRTVRGMLPHKTKR
MUS10046|Rpl13a      -----MAEGQVLVLDGRGHLLGRLAAIVAKQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNPSRG-PYHFRAPSRIFWRTVRGMLPHKTKR
RAT10046|Rpl13a      -----MAEGQVLVLDGRGHLLGRLAAIVAKQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNPSRG-PYHFRAPSRIFWRTVRGMLPHKTKR
FUG10047|RPL13A      ---MADRFNKVLVLDGRGHLLGRLSAIVAKQLLLGHKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNPSRG-PYHFRAPSRIFWRTVRGMLPHKTKR
DAN10046|Rpl13a      ---MADRFNKVLIIDGRGHLLGRLSAIVAKQVLLGHKIVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNPSRG-PYHFRAPSRIFWRTVRGMLPHKTKR
MED10046|Rpl13a      ---MADRFNKVLLIDGRGHLLGRLAAIVAKQVLLGHKVVIVRCEGINISGNFYRNKLKYLAFLRKRMNTNPSRG-PYHFRAPSRIFWRTVRGMLPHKTKR
CIO10046|RPL13A      ---MADGFVKVRIIDAKDHLLGRLAALIAKNLLNGQKIVVVRCESILISGNFYRNKLKYLDFLRKRIRTNPKRG-PFHFRAPSKILWRTVRGMLPHKLKR
DRO10064|RpL13A      ---MTGLTNRTVVIDGRGHLLGRLASVVAKYLLQGGKVAVVRCEELNLSGHFYRNKIKFLAYLRKRCNVNPARG-PFHFRAPSRIFYKAVRGMIPHKTKR
BEE10048|Rpl13a      ---MTGFSNKPILIDGRGHLLGRLAAIIAKTILQGNKVIVVRSEQLNISGNFFRNKLKFMSFLRKRCNVNPARG-PFHFRAPSKILWKTVRGMIPHKTQR
CEL10049|rpl-16      ----MGLSNRAIIIDGKNHLLGRLASIVAKKLLQGDKVVVLRAEEIVISGNFHRSKLKYMSFLRKRCNINPARG-AFHYRAPGKIFWRTVRGMLPHKTNR
BMA10046|RPL13A      ----MGLVDKPIIVDGKDHLLGRLASVVAKQLLLGQKIVIVRCEDIAISGNFHRSKLKFMSFLRKRCNVKPARG-PYHFRAPSRIFWRTVRGMLPHKTHR
STE10046|RPL13A      -----MTMDNQIVIDGAGHLLGRLASTVAKSILSGQRVVVVRCEKICISGNFYRNKLKYLDFLRKRTNTKPSHG-PFHFRAPSRIFWRTVRGMIPHKTKK
MBR10046|RPL13A      ---MSCSFEKQIVIDGRGHLLGRLASIVAKQILNGQNVVVVRSELLQISGSFYRNKLKYKEFLRKRCNVNPARG-PFHFRAPSRIFWRVVRGMVPHKTPR
NEU10047|Rpl13a      ----MSSFESVVVIDGKGHLLGRLASIVAKQLLNGQKIVVVRCEALNISGEFFRAKLKYHSYLRKMTRYNPTRGGPFHFRAPSRIFYKAVRGMIPHKTAR
GRI10046|Rpl13a      ----MSSFESVVVIDGKGHLLGRLASIVAKQLLEGQKIVVVRCEALNISGEFFRAKLKYHAHLRKITRYNPTRGGPFHFRAPSRVFYKAVRGMMPHKTAR
GRA10047|Rpl13a      ----MSSFEQVVVIDGKGHLLGRLASIVAKQLLSGQKIVIVRCEALNISGEFFRAKLKYHAHLRKITRYNPTRGGPFHFRAPSRIFYKAVRGMIPHKTAR
STA10046|Rpl13a      ----MSTFEPVIVIDGKGHLLGRLASTVAKQLLNGQKIVVVRCEALNISGEFFRAKLKYSAFMRKQTRYNPTRGGPFHFRAPSKMFWRTVRGMIPHKTAR
YAR10047|Rpl13a      ----MSTFEPVVVIDGKGHLLGRLASTVAKQILDGQNIVVVRCEALNISQEFFRSKLKYAAYLRKATRFNRTHG-PFHFRAPSRIFYKAVRGMIPHKTAR
POM10081|RPL13A-1    ----MSEFQKVVVIDAKGHLLGRLASVVAKQLLGGQKVVVVRCEELNISGHFFRNKLKYLAYLRKACRYNPSRG-AFHFRAPSRIFQKAVRGMLPHKTAR
POM10082|RPL13A-2    ----MSEFQKVVVIDAKGHLLGRLASVVAKQLLGGQKVVVVRCEELNISGHFFRNKLKYLAYLRKACRYNPSRG-AFHFRAPSRIFQKAVRGMLPHKTAR
POM10083|RPL13AC     ----MSEFQKLVIIDAKGHLMGRLASTVAKQLLAGQKVVVVRCEELNISGHFFRNKLKYLAYLRKACRYNPSRG-AFHFRAPSRIFTKAVRGMLPHKTTR
YST10081|RPL16A      -----MSVEPVVVIDGKGHLVGRLASVVAKQLLNGQKIVVVRAEELNISGEFFRNKLKYHDFLRKATAFNKTRG-PFHFRAPSRIFYKALRGMVSHKTAR
YST10082|RPL16B      ------MSQPVVVIDAKDHLLGRLASTIAKQVLNGQKIVVVRAEALNISGEFFRNKLKYHDFLRKATAFNKTRG-PFHFRAPSRILYKAIRGMVSHKTAR
CIN10047|Rpl13a      ---MATFSSTPIVIDGKGHLLGRLASIVSKQILSGQKIVVVRCEEINISGSFFRNKLRYHNFLNKRHIVNPKKSGPFHHRAPSKILYRAIRGMVPHKTAR
NEA10046|Rpl13a      ---MSAFSAQPIVIDGKGHLLGRLASVVAKQILTGQKVTVVRCEEINCSGSFFRNKIKYHNYLHKRHIVNPKKSGPFHFRAPSRILYKAIRGMVPHKSSR
MAY10046|Rpl13a      ---MSLQQANPYIVDGKGHLLGRLAATLAKELLSGQKVVVVRSELINVSGSFFRNKLKYHAYLHKRHLVNPKKAGPFHHRAPSRILYKAIRGMIPHKTAR
RHI10176|Rpl13a      ----MSTFEKVVVIDGKGHLLGRLASIISKQALNGQKVVVVRCEELNVSGEFFRNKLKYHAYLNKRCLVNPTRG-PFHFRAPSRILYKAIRGMIPHKTAR
RHI10177|Rpl13a-2    ----MSTFEKVVVIDGKGHLLGRLASIIAKQALNGQKVVVVRCEELNVSGEFFRNKLKYHAYLNKRCLVNPTRG-PFHFRAPSRILYKAIRGMVPHKTAR
RHI10178|Rpl13a-3    ----MSTFEKVVVIDGKGHLLGRLASIIAKQALNGQKVVVVRCEELNVSGEFFRNKLKYHAYLNKRCLVNPTRG-PFHFRAPSRILYKAIRGMVPHKTAR
RHI10179|Rpl13a-4    ----MSTFEKVVVIDGKGHLLGRLASIIAKQALNGQKVVVVRCEELNVSGEFFRNKLKYHAYLNKRCLVNPTRG-PFHFRAPSRILYKAIRGMVPHKTAR
RHI10180|Rpl13a-5    ----MSTFEKVVVIDGKGHLLGRLASIIAKQALNGQKVVVVRCEELNVSGEFFRNKLKYHAYLNKRCLVNPTRG-PFHFRAPSRILYKAIRGMVPHKTAR
ARA10130|At3g07110   MVSGSGICAKRVVVDARHHMLGRLASVVAKDLLNGQNIVVVRCEEICLSGGLVRQKMKYMRFLRKRMNTKPSHG-PIHFRAPSKIFWRTVRGMIPHKTKR
ARA10131|RPL13Ab     MVSGSGICSKRVVVDARHHMCGRLASIIAKELLNGQSVVVVRCEEICLSGGLVRQKMKYMRFLRKRMNTKPSHG-PIHFRAPSKIFWRTVRGMIPHKTKR
ARA10132|RPL13Ac     MVSGSGICAKRVVVDGRHHMLGRLASNTAKELLNGQEVVVVRCEEICLSGGLVRQKMKYMRFLRKRMNTKPSHG-PIHFRAPSKIFWRTVRGMIPHKTKR
ARA10133|RPL13Ad     MVSGSGICSKRVVVDARHHMLGRLASITAKELLNGQKVVIVRCEEICLSGGLVRQKMKYMRFLRKRMNTKPSHG-PIHFRAPSKIFWRTVRGMIPHKTKR
RIC10152|RPL13Ad     MVSGSGVCAPRVVVDARHHMLGRLASIIAKELLNGQRVVVVRCEEICMSGGLVRQKMKYLRFLRKRMNTKPSHG-PIHFRSPAKILWRTVRGMIPHKTKR
RIC10153|RPL13Ab     MVSGSGLCTRRVVVDARHHMLGRLASLVAKELLNGQRVVVVRCEEMCISGGLVRQKMKYLRFLRKRMNTKPSHG-PIHFRAPSRIFWRTVRGMIPHKTPR
GMA10235|LOC10049997 MVSGSGICAKRVVVDARHHMLGRLASIVAKELLNGQKVVVVRCEEICISGGLVRQKMKYLRFLRKRMNTKPSHG-PIHFRAPSKIFWRTVRGMIPHKTKR
GMA10236|LOC10052719 MVSGSGICAKRVIVDARHHMLGRLASIVAKELLNGQKVVVVRCEEICISGGLVRQKMKYLRFLRKRMNTKPSHG-PIHFRAPGKIFWRTVRGMIPHKTKR
GMA10237|LOC10081334 MVSGSGICAKRVVVDARHHMLGRLASIVAKELLNGQKVVVVRCEEICISGGLVRQKMKYLRFLRKRMNTKPSHG-PIHFRAPSKIFWRTVRGMIPHKTKR
GMA10238|LOC10080849 MVSGSGICAKRVVVDARHHMLGRLASIVAKELLNGQKVAVVRCEEICISGGLVRQKMKYLRFLRKRMNTKPSHG-PIHFRAPAKIFWRTVRGMIPHKTKR
POP10047|RPL13A      MVSGSGICVKRVVVDARHHMLGRLASIIAKELLNGQRVVVVRCEEICISGGLVRQKMKYLRFLRKRMNTKPSHG-PIHFRAPSKILWRTIRGMIPHKTKR
CRE10046|RPL13A      -------MPKTVVIDGRAHMLGRLASVVAKQILAGQQIVVVRAEEITISGGLVRQKMKYDRFLRKRMNTNPTRG-PFHFRAPSRIFWRTVRGMIPHKTAR
VOL10049|RPL13A      -------MPKTVVIDGRAHMLGRLASVVAKQILSGQQIVVVRAEDITISGGLVRQKMKYDRFLRKRMNTNPTRG-PFHFRAPSRIFWRTVRGMIPHKTAR
HEM10043|rpl13A      -------MKSFWLIEGQGHLAGRLASICAKELLNGNKIIIVKAEKIEISGKHIRNKLKFLVKSKKRTNTNPKRG-PFHFHSPSQIFWKMVRGMLPHKTKK
PTR10048|RPL13A      -----MVLSGVKVIDGRDHLLGRLCSIVAKELLAGQKIVIVRCDEICISGSLVRNRVKYAQFRRLHMNTNPGRG-PFHFKSPAMMVWRTVRGMVHQKSPR
TPS10046|Rpl13a      -----MVLEKPILIDCRDHLHGRLCSIVAKELLAGQKIILVRCEEMIISGSLVRNQTKYAQFRQKRMNTNPGRG-PFHFKSPARLVWRTIRGMVHQKTAR
CYA10047|RPL13A      ------MFEGPIVIDGRGHLLGRLAAVVAKELLNGQRIIVVRCEELVISGLFIRNKNKYLLFLQKRHASNPTRCGPWHYRAPSKIFWRTVRGMLPHKTAR
DIC10046|RPL13A      -----MFQKKAIVIDGKGHLLGRLASVVAKSLLSGQKIVVVRCEELNISGPLSRNKLKWADFLNLTMNTNHARG-HRHGRSPSKIFWRAVRGMLPHKTPR
PLA10053|RPL13A      ------MYKKEYVIDCKGHLLGRLASLIAKELLNGQRIVAVRCEDINISGSLYRNKLKYQEFLRLRTNTNPKKG-PLHLREPSKILWRCVRGMLPHKTYK
TGO10046|RPL13A      -----MTFKKVVVIDCQGHLLGRLASVVAKELLKGQQIICVRCEDINISGSLHRNRLKYQRFLRLRMNSNPRRG-PYHLRAPSRILWRTIRGMLRHKVER
GIA10046|Rpl13a      --------MSRIVIDCKGHILGRLSAIVAKELLHGHEVALVRCEKAIISGAFRDVKAHYLKKMHKRTNFNHLRG-PFHFRAPAEIVRRTIRGMIPYKTVR


HUM10047|RPL13A      GQAALDRLKVFDGIPPPYDKKKRMVVPAALKVVRLKPTRKFAYLGRLAHEVGWKYQAVTATLEEKRKEKAKIHYRKKKQLMRLRKQAEKNVEKKIDKYTE
DOG10046|Rpl13a      GQAALDRLKVFDGIPPPYDKKKRMVVPAALKVVRLKPTRKFAYLGRLAHEVGWKYQAVTATLEEKRKEKAKIHYRKKKQLMRLRKQAEKNVEKKIDKYTE
MUS10046|Rpl13a      GQAALERLKVLDGIPPPYDKKKRMVVPAALKVVRLKPTRKFAYLGRLAHEVGWKYQAVTATLEEKRKEKAKMHYRKKKQILRLRKQAEKNVEKKICKFTE
RAT10046|Rpl13a      GQAALERLKVLDGIPPPYDKKKRMVVPAALKVVRLKPTRKFAYLGRLAHEVGWKYQAVTATLEEKRKEKAKIHYRKKKQLLRLRKQAEKNVEKKICKFTE
FUG10047|RPL13A      GQAALERLKVFDGIPPPYDKRKRMVVPAALKIVRLKPSRKFAVLGRLAHEVGWKYQAITATLEEKRKEKAKLRYAKKKTVRKLTKQAEKNVEAKIAKYTD
DAN10046|Rpl13a      GQAALDRLKVFDGIPPPYDKRKRMVVPAALKIVRLKPTRKFALLGRLAHEVGWKYQAITATLEEKRKEKAKLRYSKKKVEMKLTKQAEKNVESKIAVYTD
MED10046|Rpl13a      GQAALERLKVFDGIPPPYDKRKRVVVPAALKIVRLKPSRKFALLGRLAHEVGWKYQAITATLEEKRKEKAKLHYVKKKTLVKLSKLAEKNVEGKIAKYTD
CIO10046|RPL13A      GAEALDRLKVFEGVPPPYDKKKRMVVPSCMKVVKLKPKRKFALLSRLSSEVGWKYNDVIQALEEKRKAKSKLYWDKKQSNLKIRKEAIANVQDQIADLDK
DRO10064|RpL13A      GQAALARLRVFDGIPSPYDKRRRVVVPIAMRVLTLRSDRKYCQVGRLSHEVGWHYQDVIKSLERKRKAKLRVTLKHNRELKKLTVKARENIAKAAEPFNK
BEE10048|Rpl13a      GKDALRRLKVYEGCPPPYDRRKRVVVPGAMRVMCLKPGRKYCHVGRLSHEVGWKYKAVVRTLENKRRVRSILEVQKRDKLKKLTKQAGQTVAKATAPYTA
CEL10049|rpl-16      GNEALKNLRAYEGVPAKYQKTKSLHAPSAS-RFRLQPRRKFCVVGRLSHEVGWQFQDVVAKLEAKRKVKGAAYFEQKKKMDKLAVQAKKNAAPKIAQYQK
BMA10046|RPL13A      GKAALLRLKAFDGIPQPYDRVKRQVHPAALRHLALKPRRKYCTVGRLAHEVGWQYRDIVAKLEAKRKVKSAAFYQHKKMKSKLFAEALKSDIVRNSPYQK
STE10046|RPL13A      GTEAMNRMKVFDGVPPPYDKEKRMVVPSALKVIRLKPGRKFCVLGRLSHEVGWKYQDILETLEEKRKAKSKLYFEHKKKVQKLKQTAELNKADELKSVNK
MBR10046|RPL13A      GAEALKRLKVFEGVPSPYDKIKKMVVPEALKVIRLKPERKFCTVQRLSAEFGWRYKDIVETLEDKRRAKAAEYYTQKKKLAALRRKAEANVADKVKSHTE
NEU10047|Rpl13a      GAAALERLKVFEGVPPPYDKKKKMVVPQALRVLRLQPGRKFCTVGRLSSEVGWKYEDVVSRLEERRKAKGAAYYE-RKKVAARQLSEAKKSAKVNDKTAE
GRI10046|Rpl13a      GTAALERLKVFEGVPPPYDKQKKMVVPQALRVLRLQPGRKYCTVGRLSHEVGWKYQDVVARLEERRKAKAGAYYE-RKKLVARQRSESKKTANVDKKTAE
GRA10047|Rpl13a      GAAALERLKVFEGVPPPYDKTKKVVVPQALRVLRLQPGRKFCTVGRLSHEVGWKYQDVVARLEERRKAKGAAYYE-RKKIAARQLADAKKNATVKEETSK
STA10046|Rpl13a      GNAAMERLKTFEGIPPPYDKKKRVVVPQALRVLRLKPGRKYCTVGRLGHEFGWKYQDVVARLEERRKVKGAAYYE-RKKAARRQLAEAKKSASVDGKIVE
YAR10047|Rpl13a      GKAALERLKVFEGIPPPYDKKKRMVVPQALRVLRLKPGRKYCTVGRVSHEFGWKYQDVVANLEEKRKVKSAAYYA-KKSALSKKTKAAH-AQIADSEAAK
POM10081|RPL13A-1    GQAALEHLQAVEGIPPPFDKQKRVVVPAALRVLRLKPGRKYCTVGRLSSEVGWKYNDIVAKLEERRKVKSAAFYQAKLAKQKK-----IASAKEASPVNQ
POM10082|RPL13A-2    GQAALEHLQAVEGIPPPFDKQKRVVVPAALRVLRLKPGRKYCTVGRLSSEVGWKYSDIVSKLEERRKVKSAAFYQAKLAKQKK-----IASAKAASSVNG
POM10083|RPL13AC     GNIALKNLQALEGIPPPFDKQKRLVVPAALRVLRLKPSRKYCTIGRLSSEVGWKYKNIVSKLEERRKIKSAAFYQAKSANQKH-----INVAKTKSSVNE
YST10081|RPL16A      GKAALERLKVFEGIPPPYDKKKRVVVPQALRVLRLKPGRKYTTLGKLSTSVGWKYEDVVAKLEAKRKVSSAEYYA-KKRAFTKKVASAN-ATAAESDVAK
YST10082|RPL16B      GKAALERLKIFEGIPPPYDKKKRVVVPQALRVLRLKPGRKYTTLGKLSTSVGWKYEDVVAKLEDKRKVRSAEYYA-KKRAFTKKVSSAS-AAASESDVAK
CIN10047|Rpl13a      GAAALERLKLFEGVPPPYDRKKRMVVPEALRVLRLKPGRKYCTVKRLSHEVGWGYKDVVDRLEEKRKIKAQAFHERKLAAIKLRQKATADNSSSFPQLTQ
NEA10046|Rpl13a      GAAALKRLELYEGVPPAQDRVKKMVVPAALRVLRLKPGRKYCTLKRISAEVGWNYKDVVDRLEEKRKVKGQAYFERKLRAKAEASAPKDAKLAEFGY---
MAY10046|Rpl13a      GAAALQRLKVYEGVPPPYDRKKLMVIPAALRVLRLKPGRKFATIKRISHEVGWNHMETVDKLEAKRKVKQQAYHERQVAASKKRAAAQTATADKLKDVNA
RHI10176|Rpl13a      GAAALDRIKLFEGVPAPYDRVKRMVVPDALRVLRLKPGRKYTTIGRISHEVGWKYQDIVAKLEEKRKAKSAAYYQRKVALAAIQKKAVEAKAESVKEINS
RHI10177|Rpl13a-2    GAAALDRIKLFEGVPAPYDRVKRMVVPDALRVLRLKPGRKYTTIGRISHEVGWKYQDIVAKLEEKRKAKSAAYYQRKVALAAIQKKAVESKADSIKDINT
RHI10178|Rpl13a-3    GAAALDRIKLFEGVPAPYDRVKRMVVPDALRVLRLKPGRKYTTIGRISHEVGWKYQDIVAKLEEKRKAKSAAYYQRKVALAAIQKKAVESKADSVKEINS
RHI10179|Rpl13a-4    GAAALDRIKLFEGVPAPYDRVKRMVVPDALRVLRLKPGRKYTTIGRISHEVGWKYQDIVAKLEEKRKAKSAAYYQRKVALAAIQKKAVESKADSVKEVNS
RHI10180|Rpl13a-5    GAAALDRIKLFEGVPAPYDRVKRMVVPDALRVLRLKPGRKYTTIGRISHEVGWKYQDIVAKLEEKRKAKSAAYYQRKVALAAIQKKAVESKADSVKEVNT
ARA10130|At3g07110   GANALARLKVFEGVPTPYDKIKRMVVPDALKVLRLQAGHKYCLLGRLSSEVGWNHYDTIKELENKRKERAQAVYERKKQLSKLRAKAEKVAEEKLGSQLD
ARA10131|RPL13Ab     GAAALARLKVFEGVPPPYDKVKRMVIPDALKVLRLQAGHKYCLLGRLSSEVGWNHYDTIKELEVKRKERSQALYERKKQLTKLRAKAEKVAEEKLGSQLD
ARA10132|RPL13Ac     GAAALARLKVFEGIPPPYDKIKRMVIPDALKVLRLQSGHKYCLLGRLSSEVGWNHYDTIKELETKRKERSQVMYERKKQLNKLRTKAEKVAEERLGSQLD
ARA10133|RPL13Ad     GAAALARLKVYEGVPTPYDKIKRMVIPDALKVLRLQAGHKYCLLGRLSSEVGWNHYDTIKELETKRKERAHVVYERKKQLNKLRVKAEKVAEEKLGAQLD
RIC10152|RPL13Ad     GEAALARLKAYEGVPPPYDRTKRMVIPDALKVLRLQPGHKYCLLGQLSKEVGWNYYDTIRELEEKRKEKAKVAYDRRKQLAKLRVKAEKAAEEKLGPQLE
RIC10153|RPL13Ab     GEAALANLKAFDGVPPPYDRTKRMVVPDALKVLRLQPGHKYCLLGQLSKEVGWNYHDTIRELEEKRKEKAKVAYERRKQLTRLRVKAEKAAEEKLGSQID
GMA10235|LOC10049997 GEAALARLKVYEGIPPPYDKTKRMVVPDALKVLRLQKGHKYCVLGRLSSEVGWSYYDTIRELEKKRKEKAAVVYERKKQLNKLRVKAEKVAEEKLGSQLD
GMA10236|LOC10052719 GEAALARLKVYEGIPPPYDKTKRMVVPDALKVLRLQKGHKYCHLGQLSSEVGWNYYDTIRELEKKRKDRAQLCYERKKQLAKLREKAEKVAEKKLGSQIE
GMA10237|LOC10081334 GEAALARLKVYEGIPPPYDKIKRMVVPDALKVLRLQKGHKYCILGRLSSEVGWSYYDTIRELEKKRKEKAQLVYERKKQLNKLRVKAEKVAEDKLGSQLD
GMA10238|LOC10080849 GEAALARLKVYEGIPPPYDKTKRMVVPDALKVLRLQKGHKYCVLGRLSPEVGWSYYDTIRELEKKRKEKAELVYARKKQLNKLRVKAEKVAEEKLGSQLD
POP10047|RPL13A      GEAALARLKVFEGVPPPYDKTKRMVIPDALKVLRLQPGHKYCLLGQLSSEVGWNHYDTIKELETKRKERAQLVYERKKQLAKLRLKAEKTAEEKLGPQQE
CRE10046|RPL13A      GAAALERLKAFEGIPHPYDKVKRLVVPDALKVLRLQHGHRNCKLGDLSASVGWKHQAAVAELEEKRKAKAKAFYVAKKKLVALRSKAAAQVKAFGGVWCC
VOL10049|RPL13A      GAAALERLKAFEGVPHPYDKVKRMVVPDALKVLRLQHGHRCCKLGDLSAAVGWKHQAAVAELEEKRKAKAKAFYVAKKKLIALRVKAAAQVKA-------
HEM10043|rpl13A      GTSALMKLKVFEGLPEPFNRMKKFIIPSALRVSRLLTGRKYSILGEIANQIGWTRKNIIDSIVWNRNIESKLFYNQKVNSLKKKTANYNAKVSFISNLMN
PTR10048|RPL13A      GQEALKRLSTFEGIPAPYDKQKRVVVPAALRVMRLKPGRQFTVVGELADSVGWKHKELLGRLEGKRKAEAKDFYEKKKEKAALRKKAEAAAAGELAKVNE
TPS10046|Rpl13a      GQAAIGRLSTFEGIPHPYDKMKRKVVPAALRVVRLKPGRKYTKMGDLANNVGWKHKELVDQLEDKRRAKAETFYAKKKAAAALRAKAEEAAAGDLAKVNE
CYA10047|RPL13A      GAQALARLETFDGIPPPYDKAKRRVVPCALRILRLRPDRKWTRLGRLSAEVGWKRAAIVDKLEEKRKKLAQERYERRKQENKLLEEAKARAEAKLPADLK
DIC10046|RPL13A      GQAALDNMKVFEGVPAPYDKVKRVVVPSALRVVKLNTTRKYTVLSRLSQEVGWKYRAVVAKLEVQRKQRSSTYYRKAALVKAYRTQALKKFSA-------
PLA10053|RPL13A      GQLALKKLKVCVGMPYPYDKKKKYVLPSALRAFRLKKHRRYCRLGTLSSRVGWNYDTLVKKNEVLRKQVSKAYYKKKVNNLNEKKEIKTEALNLINPEQR
TGO10046|RPL13A      GQKALARLQVFEGVPTMVERKKRMVVPSALRIVRLKPKRNFCRLGDLSSQVGWSHGDLVARLEEKRKTRSSAYYQKKKERTKMQAEAKSFAQTTLPKDQV
GIA10046|Rpl13a      GSDAMSRLRVYDGIPPCCARYKRVVCPSAMAYLCLRPERRRCEVGRVAHEIGWQHAADVERYEKRRLEECDKWYQDKIQIDKKIAEAAEKDAELQRINAE


HUM10047|RPL13A      VLKTHGLLV-------------
DOG10046|Rpl13a      VLKTHGLLV-------------
MUS10046|Rpl13a      VLKTNGLLV-------------
RAT10046|Rpl13a      VLKTNGLLV-------------
FUG10047|RPL13A      VLKQYGILV-------------
DAN10046|Rpl13a      VLKKYGVLV-------------
MED10046|Rpl13a      VLKQYGVLV-------------
CIO10046|RPL13A      QIQDMGCYAV------------
DRO10064|RpL13A      IIKSYGYEV-------------
BEE10048|Rpl13a      IINNFGYN--------------
CEL10049|rpl-16      IIEALGYN--------------
BMA10046|RPL13A      LIESYGYQ--------------
STE10046|RPL13A      TLAGYGY---------------
MBR10046|RPL13A      TLAQYGF---------------
NEU10047|Rpl13a      ALKEFGY---------------
GRI10046|Rpl13a      TLQAYGY---------------
GRA10047|Rpl13a      ALANYGY---------------
STA10046|Rpl13a      SLTSLGY---------------
YAR10047|Rpl13a      ALAALGY---------------
POM10081|RPL13A-1    KLSQFGY---------------
POM10082|RPL13A-2    KLAEFGY---------------
POM10083|RPL13AC     KLAVFGY---------------
YST10081|RPL16A      QLAALGY---------------
YST10082|RPL16B      QLASFGY---------------
CIN10047|Rpl13a      LGY-------------------
NEA10046|Rpl13a      ----------------------
MAY10046|Rpl13a      QLASYGY---------------
RHI10176|Rpl13a      SIAALGY---------------
RHI10177|Rpl13a-2    SIAALGY---------------
RHI10178|Rpl13a-3    AIAVLGH---------------
RHI10179|Rpl13a-4    AIAALGY---------------
RHI10180|Rpl13a-5    AIAALGY---------------
ARA10130|At3g07110   VLAPVKY---------------
ARA10131|RPL13Ab     VLASIKY---------------
ARA10132|RPL13Ac     VLAPVKY---------------
ARA10133|RPL13Ad     ILAPVKY---------------
RIC10152|RPL13Ad     ILAPIKY---------------
RIC10153|RPL13Ab     ILAPIKY---------------
GMA10235|LOC10049997 VLAPVKY---------------
GMA10236|LOC10052719 ILAPVKY---------------
GMA10237|LOC10081334 ILAPVKY---------------
GMA10238|LOC10080849 VLAAVKY---------------
POP10047|RPL13A      IIAPLKY---------------
CRE10046|RPL13A      GASPRATRQGRREQCRWTCNGL
VOL10049|RPL13A      ----------------------
HEM10043|rpl13A      LNFQ------------------
PTR10048|RPL13A      VLAASGY---------------
TPS10046|Rpl13a      VLAASGY---------------
CYA10047|RPL13A      EILVSCGYA-------------
DIC10046|RPL13A      ----------------------
PLA10053|RPL13A      QVLENFGYA-------------
TGO10046|RPL13A      AFLQQYGHA-------------
GIA10046|Rpl13a      LAKYGY----------------