CLUSTAL W (2.1) Multiple Sequence Alignments
HAL10024|VNG1138G    -------MSLAEFDADVVVDARDCIMGRVASNVAERALA------------GDRVAVVNAEQAVITGTEDDVFSTYRTRANLGSDRG-----PYYPKRPD
MET10037|MJ0194      ---------------MTVIDAEGAILGRLASEVAKRVLR------------GEEIVIVNAEMVVITGNKDWIIKTYQEEREKKNVANPRRFGPKFPRRPD
PYR10023|PH1634      ---------------MRIINADGLILGRLASRVAKMLLE------------GEEVVIVNAEKAVITGNREVIFSKYKQRTGLRTLTNPRRG-PFYPKRSD
THE10031|TTHA1465    ---VKTYVPKQVEPRWVLIDAEGKTLGRLATKIATLLRGKHRPDWTPNVAMGDFVVVVNADKIRVTGKK-LEQKIYTRYSGYPGGLKKIPLEKMLATHPE
SYN10033|sll1821     MNKTVLPTIDNLDHKWYVIDAEGQRLGRLATEVATILRGKNKPTFTPHMDTGDFVIIINAEKIEVTGRK-REQKLYRRHSGRPGGMKEETFEKLQVRLPE
BAC10032|Bsu0149     MRTTPMANASTIERKCLVVDAAGKTLGRLSSEVAAILRGKHKPTYTPHVDTGDHVIIINAEKIELTGKK-LTDKIYYRHTQHPGGLKSRTALEMRTNYPE
ECO10032|rplM        -MKTFTAKPETVKRDWYVVDATGKTLGRLATELARRLRGKHKAEYTPHVDTGDYIIVLNADKVAVTGNK-RTDKVYYHHTGHIGGIKQATFEEMIARRPE
SUL10025|ST2065      -----------MSEQLVVVNAENQILGRMATHIAKLLIQ------------GKRVVVVNAEKAIISGPRARVVRGYSLIFSVRKFQNPEKNTIKRPRTPI


HAL10024|VNG1138G    GIFKRAIRGMLPYKQDDGREALDSVRVYVGNPMDEDG---DVLDGTSLDRLSTIRFVTLSEVSEELGANVTW
MET10037|MJ0194      DILRRTIRKMLPYKKPKGREAFKRVKVYVGNPKNLT------VDEKISHKLNTTKYITLAELSKHLGAKF--
PYR10023|PH1634      EIVRRTIRGMLPWKTDRGRKAFRRLKVYVGIPKEFQDKQLETIVEAHVSRLSRPKYVTVGEVAKFLGGKF--
THE10031|TTHA1465    RVLEHAVKGMLP-KGPLGRRLFKRLKVYAGPDHPHQAQRPEKLEV---------------------------
SYN10033|sll1821     RIVESAVRGMLP-KNSLGRKLFTKLKVYAGPSHPHAAQQPETLVINTIPAGAN-------------------
BAC10032|Bsu0149     KMLELAIKGMLP-KGSLGRQMFKKLNVYRGSEHPHEAQKPEVYELRG-------------------------
ECO10032|rplM        RVIEIAVKGMLP-KGPLGRAMFRKLKVYAGNEHNHAAQQPQVLDI---------------------------
SUL10025|ST2065      NIVKRTVRGMLPKNKS-GKMMFKNLIVFIGIPAEYKDKQMIRFEDADVKRLKG-KYITVGELSKLLGGFSQ-