CLUSTAL W (2.1) Multiple Sequence Alignments
HAL10026|VNG1718G    ------------MTDKKRRQRGSRTHGGGTHKNRRGAGNRGGRGRAGR--------KKHEQHNYEDVGKSGFKRPEKTDRDVAVLSVQELDEDIPVLSES
MET10041|MJ0477      ---------MIRKKKKVKKIRGSRTCGGGSHKKRRGAGNKGGRGMAGG---HKHKWTWIIKYCPDYFGKYGFKRHPSLVKRLETINVGELEEIVLKNPDK
PYR10025|PH1755      LRECSEVARMIRRRKKVRKLRGSHTHGWGCKKKHRGGGSKGGRGMAGTGKRNKSKWTWTIKYAPDHLGKRGFSRPPEVQRDVRIVTLKFIDEHLEDLLQM
THE10033|TTHA1673    --MKLSDLRPNPGANKRRKRVGRGPGSGHGKTATRGHKGQKSRSGGLKDPRRFEGGRSTTLMRLPKRGMQGQVPGEIKRPRYQGVNLKDLARFEG--EVT
SYN10035|sll1813     --MNLSELSPKDGAKKRRRRVGRGIAAGQGASCGFGMRGQKSRSGTGTKAG-FEGGQMPLYRRLPKLKHFPLYN----PKHFTVVNVGKLAGLAPNTVVT
BAC10034|Bsu0135     --MKLHELKPSEGSRKTRNRVGRGIGSGNGKTAGKGHKGQNARSGGGVRPG-FEGGQMPLFQRLPKRG-FTNIN----RKEYAVVNLDKLNGFAEGTEVT
ECO10034|rplO        --MRLNTLSPAEGSKKAGKRLGRGIGSGLGKTGGRGHKGQKSRSGGGVRRG-FEGGQMPLYRRLPKFG-FTSRK----AAITAEIRLSDLAKVEG-GVVD
SUL10027|ST0412      --------MTVRKEKKSRKYRGYRTHGWGTKGQHRDRGAQGSRQIG----MHKEKWSWLVKYGEGWYGKHGFVNP--TSKVYNVITMRKLQELIEK-GEI


HAL10026|VNG1718G    GVAEETEFGYRVDARDVVDDGWDADVVKVLGGGQLYEQLEVTADAFSDAAVELIEGEGGDAVVSERASEDDEE
MET10041|MJ0477      -FEKEDDK--------FVVDVIELGYEKVLGKGKVTIPMIVKAVEVSEKAREKIEAVGGEVVEL---------
PYR10025|PH1755      GIAYEEEG--------KIVVDTTQFADKVLGTGRLTRPLTIKAKAFSAKAEEKIKAAGGEVILA---------
THE10033|TTHA1673    PELLVRAG----------LLKKG-YRLKILGEG-EAKPLKVVAHAFSKSALEKLKAAGGEPVLLEA-------
SYN10035|sll1813     LESLMEAG----------IVTSNDGPLKVLGNGELAVALTVHAP-CSKAAQAKIEAAGGSVVAQG--------
BAC10034|Bsu0135     PELLLETG----------VISKLNAGVKILGNGKLEKKLTVKANKFSASAKEAVEAAGGTAEVI---------
ECO10034|rplO        LNTLKAAN----------IIGIQIEFAKVILAGEVTTPVTVRGLRVTKGARAAIEAAGGKIEE----------
SUL10027|ST0412      KIKDENGK--------KVVDLTEYRYDKLIGSSGLKIPLVIKVNMASKKAIEKVKELGGQIILTTSE------