CLUSTAL W (2.1) Multiple Sequence Alignments
THE10035|TTHA1663    MRHLKSGRKLNRHSSHRLALYRNQAKSLLTHGRITTTVPKAKELRGFVDHLIHLAKRGDLHARRLVLRDLQ--------DVKLVRKLFDEIAPRYRDRQG
SYN10037|sll1819     MRHRCRVPQLGKPADQRKALLRALTTELIRHGQIKTTKARAKAVRSEVDRMITLAKDGSLAARRRALGYMY--------DKPTVHALFADAPSRYKDRDG
BAC10036|Bsu0144     ----MSYRKLGRTSAQRKAMLRDLTTDLIINERIETTETRAKELRSVVEKMITLGKRGDLHARRQAAAYIRNEVANEENNQDALQKLFSDIATRYEERQG
ECO10036|rplQ        MRHRKSGRQLNRNSSHRQAMFRNMAGSLVRHEIIKTTLPKAKELRRVVEPLITLAKTDSVANRRLAFARTR--------DNEIVAKLFNELGPRFASRAG


THE10035|TTHA1663    GYTRVLKLAERRRGDGAPLALVELVE----------
SYN10037|sll1819     GYTRIIRTL-RRRGDNAEMAVIELV-----------
BAC10036|Bsu0144     GYTRIMKLG-PRRGDGAPMAIIELV-----------
ECO10036|rplQ        GYTRILKCG-FRAGDNAPMAYIELVDRSEKAEAAAE