CLUSTAL W (2.1) Multiple Sequence Alignments
HUM10052|RPL18A      ------MKASGTLREYKVVGRCLPTPKCHT----PPLYRMRIFAPNHVVAKSRFWYFVSQLKKMKKSSGEIVYCGQVFEKSPLRVKNFGIWLRYDSRSGT
DOG10051|Rpl18a      ------MKASGTLREYKVVGRCLPTPKCRT----PPLYRMRIFAPNHVVAKSRFWYFVSQLKKMKKSSGEIVYCGQVFEKSPLRVKNFGIWLRYDSRSGT
MUS10051|Rpl18a      ------MKASGTLREYKVVGRCLPTPKCHT----PPLYRMRIFAPNHVVAKSRFWYFVSQLKKMKKSSGEIVYCGQVFEKSPLRVKNFGIWLRYDSRSGT
RAT10051|LOC290641   ------MKASGTLREYKVVGRCLPTPKCHT----PPLYRMRIFAPNHVVAKSRFWYFVSQLKKMKKSSGEIVYCGQVFEKSPLRVKNFGIWLRYDSRSGT
FUG10052|RPL18A      ------MKASGTLREYKVIGRLLPSAKNPA----PPLYRMRIFAPNHIVAKSRFWYFVSQLRKMKKASGEIVYCGLVHEKTPLKVKNFGIWLRYDSRSGT
DAN10051|Rpl18a      ------MKASGTLREYKVVGRLLPSVKNPA----PPLYRMRIFAPNHVVAKSRFWYFVSQLRKMKKASGEIVYCGLVFEKSPLKVKNFGIWLRYDSRSGT
MED10051|Rpl18a      ------MKASGTLREYKVIGRLLPSAKNPT----PPLYRMRIFAPNHVVAKSRFWYFVSQLRKMKKASGEIVYCGLVHEKSPLKVKNFGIWLRYDSRSGT
CIO10051|RPL18A      ------MKAKGELQEYKVVGRKLPSEAVPN----PPLYRMRLFAPNHIAAKSRFWYYISYYKKIKKNAGEILQCSKRSEPRPGRVKNFGIWLRYDSRSGT
DRO10072|RpL18A      ------MRSHLQLKEYEVVGRKLPSEKEPQ----TPLYKMRIFAPDNIVAKSRFWYFLRQLKKFKKTTGEIVSIKQVYETSPVKIKNFGIWLRYDSRSGT
MOS10052|Rpl18a      ------MKAKGVLKEYQVIGRKLPSEKEKN----PPLFKMHIFAPDHIVAKSRFWYFLRQLRKFKKATGEIVSVKRILEKTPLKVKNFGIWLRYDSRSGT
BEE10053|Rpl18a      ------MKAKGELKEFEVIGRKLPTEKEKS----TPLYKMRIFAPDAIVAKSRFWYFLRQLKKFKKSTGEIVSLKQIPEKSPVKIKNFGIWLRYDSRSGT
CEL10054|rpl-20      ---MPTKALGETLNEYVVVGRKIPTEKEPV----TPIWKMQIFATNHVIAKSRFWYFVSMLRRVKKANGEILSIKQVFEKNPGTVKNYGVWLKYDSRTGH
BMA10051|RPL18A      ---MPTKSKGETLREFLVVGRKLPSAKELN----PPIYKMQIFASNHVIAKSRFWYFTSMLRRVKKANGEILECKEVFEKKPGYVKNYGIWLRYDSRTNH
STE10051|RPL18A      ------MKVQGELKEFQVIGRLMPNKKLTV----PPLYKMRIFAPDDVVARSKFWYFISQLKRMKKSQGEIVSCQQIYEKKPLQIKNFGIWLRYDSRSGT
MBR10051|RPL18A      ------MAHCPHLFQYEIIGRKLPSAQDPK----PKLYKMTIFAPNEVVAKSRFWYFLPQLKKMKKTTGQIVNIQKMHETREGVVRNYGIWLRYNSRSGT
NEU10052|Rpl18a      ---------MGRLQEYQVIGRHLPTESNPT----PALYRMRIFAPNAVVAKSRFWYFLRGLRKVKKATGEIVTCNVITEKHPLKVKNFGVWIRYDSRSGT
GRI10051|Rpl18a      ---------MGRLQEYQVIGRHLPTESNPT----PSLYRMRIFAPNEVVAKSRYWYFLRGLKKVKKATGEIVAVNKIHEKHPLKVKNFGIWIRYNSRSGT
GRA10052|Rpl18a      ---------MGRLQEYEVIGRHLPTEADPT----PALYRMTIFAPNETVAKSRYWYFLRGLKKVKKATGEIVSVKVLHEKHPLKVKNFGVWIRYDSRSGT
STA10051|Rpl18a      ---------MARFSEYQIIGRHLPSEANPT----PKIYRMRIFAPNEVVAKSRFWYFLGKLRKIKKANGEIVSVNQIHEKRPQKVKNFGIWIRYDSRSGT
YAR10052|Rpl18a      ---------MGRLNEYQVIGRKLPTEAAPE----QKLYRMRIFAPNEVVAKSRFWYFLTQLKKVKKSTGEIVAINKISEKTPTKVKNFGIWIRYDSRSGT
POM10093|RPL18A-1    ----------MALKEYQVVGRKVPTEHEPV----PKLFRMRLFAPNESVAKSRYWYFLKMINKVKKATGEIVAINEISEPKPLKAKVFGIWIRYDSRSGT
POM10094|RPL18A-2    ----------MALKEYQVVGRKVPTEHEPV----PKLFRMRLFAPNESVAKSRYWYFLKMINKVKKATGEIVAINEISEPKPLKAKVFGIWIRYDSRSGT
YST10091|RPL20A      -MKILVILSVAHFKEYQVIGRRLPTESVPE----PKLFRMRIFASNEVIAKSRYWYFLQKLHKVKKASGEIVSINQINEAHPTKVKNFGVWVRYDSRSGT
YST10092|RPL20B      -------MYLAHFKEYQVIGRRLPTESVPE----PKLFRMRIFASNEVIAKSRYWYFLQKLHKVKKASGEIVSINQINEAHPTKVKNFGVWVRYDSRSGT
CIN10052|Rpl18a      ----------MGIKEFQVVGRHLPTEHEPT----PKIYRMRIFAPNEVVAKSRYWYFMRQLKKVKKASGEILAVTPILEKRPLQVKNFGIWLRYDSRSGT
NEA10051|Rpl18a      ---------MARFTEYSVVGRTLPTEADPA----PKLYRMRIFAPNEVVAKSRYWYYLRQLKKAKKAHGEIVALNVIHEKKPLKVKNFAIWLRYDSRSGT
MAY10051|Rpl18a      ---------MTRLTEYMVIGRHLPTEKEPS----PKLYRMRIFAVNKSVAESRFWYFVRQLRKMKKATGEIVAIHAIHEKKPIKVKNFAVWLRYNSRSGT
RHI10199|Rpl18a      ---------MARFHEYQVVGRKLPSETEAS----PKLFRMRIFAPNVVVAKSRFWYFLKKLRKVKKAAGEIVAVNEIHEKRPEQIKNFGIWIRYDSRSGT
RHI10200|Rpl18a-2    ---------MARFHEYQVVGRKLPSETEAS----PKLFRMRIFAPNVVVAKSRFWYFLKKLRKVKKAAGEIVAVNEIHEKRPEQIKNFGIWIRYDSRSGT
RHI10201|Rpl18a-3    ---------MARFTEYQVVGRKLPSATEAS----PKLFRMRIFAPNVVVAKSRFWYFLKKLRKVKKAAGEIVAVNEIHEKRPEQIKNFGIWIRYDSRSGT
RHI10202|Rpl18a-4    --------MVCRLKEYQVVGRKLPSETEAS----PKLYRMRIFAPNDVVAKSRFWYFLKKLRKVKKAAGEIVALNQIHEKRPEQIKNFGIWIRYDSRSGT
RHI10203|Rpl18a-5    --------MVCRLKEYQVVGRKLPSETEAS----PKLYRMRIFAPNDVVAKSRFWYFLKKLRKVKKAAGEIVALNQIHEKRPEQIKNFGIWIRYDSRSGT
ARA10143|RPL18Aa     -------MSVIRLHQYQVVGRALPTEKDEQ----PKIYRMKLWATNEVLAKSKFWYYLRRQKKVKKSNGQMLAINEIFEKNPTTIKNFGIWLRYQSRTGY
ARA10144|RPL18Ab     -------MGAFRFHQYQVVGRALPTEKDVQ----PKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQMLAINEIYEKNPTTIKNFGIWLRYQSRTGY
ARA10145|RPL18Ac     -------MGGFRFHQYQVVGRALPTENDEH----PKIYRMKLWGRNEVCAKSKFWYFMRKLKKVKKSNGQMLAINEIFEKNPTTIKNYGIWLRYQSRTGY
RIC10168|RPL18Ab     -------MGAFRFHQYQVVGRGLPTPTDEH----PKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQILAINEIFEKNPTTIKNYGIWLRYQSRTGY
RIC10169|RPL18Ac     -------MVAFRFHQYQVVGRALPTPGDEH----PKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQMLAINEIFERNPTTIKNYGIWLRYQSRTGY
GMA10259|LOC10052700 -------MVAMRFHQYQVVGRALPTESDEH----PKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFERNPTKIKNYGIWLRYQSRTGY
GMA10261|LOC10030636 -------MVTFRFHQYQVVGRALPTETDVH----PKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQMLAINEIFEKNPTKIKNYGIWLRYQSRTGY
GMA10262|LOC10050010 -------MVTFRFHQYQVVGRALPTEADQH----PKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFEKNPTKIKNYGIWLRYQSRTGY
GMA10263|LOC10030617 -------MVTFRFHQYQVVGRALPTEADQH----PKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFEKNPTKIKNYGIWLRYQSRTGY
GMA10264|LOC10030560 -------MVAMRFHQYQVVGRALPTESDEH----PKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFEKNPTKIKNYGIWLRYQSRTGY
POP10052|RPL18A      -------MVTFRFHQYQVVGRALPTQSDEH----PKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFEKNPTTIKNYGIWLRYQSRTGY
CRE10051|RPL18A      ----MVMQGNFKFHQYQVVGRHLPTAADAN----PTVYRMKVWAEDDVKAKSKFWYFLRKLRRVKKANGQIIACNEIFERKPTLAKNYGIWVRYQSRTGV
VOL10054|RPL18A      ----MVMQGNFKFHQYQVVGRHLPTAADAT----PTVYRMKVWAEDDVKAKSKFWYFLRKLRRVKKANGQIIACNEIFERKPTLAKNYGVWVRYQSRTGV
HEM10048|rpl18A      ----------MWLKQYYVIGRQWPSEKKPE----PELFFMKIFSPNESIAKSRFWYFLRKTQKIKKVKGEIVSVKKITEKKNKNVKNFGIWLRYDSKSGT
PTR10053|RPL18A      ------MTVAGLMRQYQVVGRHAANEEHPN----PEAYRMIIFAPNPTIAKSKFWYYMHQFRKMKKTTGEILDCVELVEKNSRIVKNYGIWLRYSSRSGT
TPS10051|Rpl18a      ------MTVAGAMRQYQVVGRKAGTDENPN----PEAYRMIIFAPNPTVAKSKFWYFMRQFRKMKKTTGEILDCVEIIEKNSRTVKNYGIWLRYDSRSGT
CYA10052|RPL18A      ----------MPFKQYVVVGRRLPEQQLVKGAVDDTLYKMVIYAPDPVKAKSKYYYFLSQLLKTKRSTAEVVAITEVKERDTTRVKNYTIWLRYRSRTGQ
DIC10051|RPL18A      ---------MIPIHEFQVVGRHVPTERDAN----PKIYRMRLFAQTSIHAKSRFWYFLSKIVKMKKSTGEILNVTEIFEDKPQKVKNFGVFIRYNSRSGT
PLA10058|RPL18A      MVKKIDNSLNTNIHQYHIVGRAIPTAKDKN----PNVYRMCIFAKNDTNAKSRFWYFMKKINKLKKSNGELLACEQIKERFPLRVKNYGVLLRYDSRTGT
TGO10051|RPL18A      --MKADPTLQQKISQYQVVGRKQPTEAEPN----PSLFRMRLFARNKVLAVSKFWYLLKKMKKVKKSTGEILAVNEIREKRPTFVKNFGVWLRYDSRTGT
GIA10051|Rpl18a      -----------MMQKYIVYGRRLPSEKFPE----PEVFRMTIYAPNEIVAKSRFWYHLKSLKKIKRTHGEILDCQHIEE-NGDFVKNFGVLLRYRSRVGQ
MET10033|MJ0595      ---------------------------------------------------------------------------------LAKIFRITGIMSKKGKD-P
PYR10049|PHS021      --------------------------------------------------------------------------------MEVKVFRVSGYFEKDGR--K
SUL10057|STS167      -----------------------------------------------------------------------------MSEIKTYVIRAIVTFNASHYPMK


HUM10052|RPL18A      HNMYREYRDLTTAGAVTQCYRDMGARHRARAHSIQIMKVEEIAASK-CRRPAVKQFHDSKIKFPLPHRVLRR-------QHKPRFTTKRPNTFF------
DOG10051|Rpl18a      HNMYREYRDLTTAGAVTQCYRDMGARHRARAHSIQIMKVEEIAASK-CRRPAVKQFHDSKIKFPLPHRVLRR-------QHKPRFTTKRPNTFF------
MUS10051|Rpl18a      HNMYREYRDLTTAGAVTQCYRDMGARHRARAHSIQIMKVEEIAAGK-CRRPAVKQFHDSKIKFPLPHRVLRR-------QHKPRFTTKRPNTFF------
RAT10051|LOC290641   HNMYREYRDLTTAGAVTQCYRDMGARHRARAHSIQIMKVEEIAAGK-CRRPAVKQFHDSKIKFPLPHRVLRR-------QHKPRFTTKRPNTFF------
FUG10052|RPL18A      HNMYREYRDLTTSGAVTQCYRDMGARHRARAHSIQIMKVQVIAANK-CRRPAIKQFHDSKIKFPLPHRVLRR-------QHKPRFTTKRPNTFY------
DAN10051|Rpl18a      HNMYREYRDLTTSGAVTQCYRDMGARHRARAHAIQIMKVQVIAANK-CRRPAIKQFHDSKIKFPLPHRVLRR-------QHKPRFTTKRPNTFF------
MED10051|Rpl18a      HNMYREYRDLTTSGAVTQCYRDMGARHRARAHAIQIMKVQVIAANK-CRRPAIKQFHDSKIKFPLPHRVLRR-------QHQPRFTTKRPNTFF------
CIO10051|RPL18A      HNMYREYRDVKVASAVTACYRDMGARHRARPGSIQIMRVEEVAANK-CKRKHVQQFHDSKIKFPMRRTVLSK-----KQQNAPRFTTNKPNLFF------
DRO10072|RpL18A      HNMYREYRDLTVGGAVTQCYRDMGARHRARAHSIQIIKVDSIPAAK-TRRVHVKQFHDSKIKFPLVQRVHHK-------GNRKLFSFRKPRTYFQ-----
MOS10052|Rpl18a      HNMYREYRDLTVGGAVTQCYSDMASRHRARAHSIQIIKVESIAASK-TRRAHIKQFHNSKIRFPLVQRYHHK-------RYRKLFSYRRPETFYQ-----
BEE10053|Rpl18a      HNMYREYRDLSVSGAVTQCYRDMGARHRARAHSIQIIKVEVVKAAN-CRRPQVKQFHDSKIRFPLPKRIHHR-------NRMPLFSVRKPRTYFL-----
CEL10054|rpl-20      HNMYREYRDTTVAGAVTQCYRDMGARHRAQADRIHILKVQTVKAED-TKRAGIKMFHDAKIRFPLPHRVTKR-------KNLSVFTTARQNTHFA-----
BMA10051|RPL18A      HNMYREYRDNTVAGAVTQCYRDMGARHRAQADRIQIIKVQVIKASD-CKRAAIKQFHNSKICFPLPHRIAKR-------RNAAIFTTRRPRTHFS-----
STE10051|RPL18A      HNMYREYRDLTVSGAVTACYRDMAARHRARGYSIQIMKVEVIPASK-ARRPHVKQMHNSKIKFPFPHRIMKS-------QFKSKFVAKRPNTMY------
MBR10051|RPL18A      HNMYREYRDVSLANAVSKMYREMAGRHSCRAHSIQIIRTDVVASSD-IKREHIKQFLNPDIKFPLPHRRIASQFKS-------RFVAKRPTTFFG-----
NEU10052|Rpl18a      HNMYKEYRELSRTAAVEALYSDMAARHRARFRSIHILKVVELEKTEDIKRPYLKQLVTKKLSFPLPH---RVP----KISNKKIFSAKRPATFA------
GRI10051|Rpl18a      HNMYKEYRELSRTAAVEAMYQDMAARHRARFASIHILRVVELEKTDDIKRPYIKQLTTKGLTFPLPH---RVP----KINNKKIFSARRPSTFA------
GRA10052|Rpl18a      HNMYKEYRELSRTDAVESLYSDMAARHRARFRSIHVLRVVEIEKTEDIKRPYIRQLTQKNLSFPLPH---RIT----KENTQKLFSAKRPSTFA------
STA10051|Rpl18a      HNMYKEYREMSRVAAVDALYQDMAARHRSRFRQVQILKVVEIEKSDDVRRPYIKQLLVKGLKFPLPH---RIN----KKAGKKVFAAKRPSTFF------
YAR10052|Rpl18a      HNMYKEYRDVSRTNAVEMLYQDMAARHRSRFRSIHVLKVVELESEEDVKRQYVKQLLAPDLKFPLPH---RVQ----KSR--NIFASKRPSTFY------
POM10093|RPL18A-1    HNMYKEFRDTTRVGAVEAMYADMAARHRARFRSIRILKVVEVEKKEDVRRNYVKQLLNPHLKFPLPHR--RTGVV--GLAGKKVFAPHRPSTFY------
POM10094|RPL18A-2    HNMYKEFRDTTRVGAVEAMYADMAARHRARFRSIRILKVVEVEKKEDVRRNYVKQLLNPHLKFPLPHR--RTGVV--GLAGKKVFAPHRPSTFY------
YST10091|RPL20A      HNMYKEIRDVSRVAAVETLYQDMAARHRARFRSIHILKVAEIEKTADVKRQYVKQFLTKDLKFPLPH---RVQ----KST--KTFSYKRPSTFY------
YST10092|RPL20B      HNMYKEIRDVSRVAAVETLYQDMAARHRARFRSIHILKVAEIEKTADVKRQYVKQFLTKDLKFPLPH---RVQ----KST--KTFSYKRPSTFY------
CIN10052|Rpl18a      HNMYKEFRDLSRAGAVKALYQDMSARHRARFRSIHIIRVVEIKKAEDVRRPYVKQLLQPGLKFPLPHR--VPKVR-------STFVAKRPSTF-------
NEA10051|Rpl18a      HNMVKEFRALSRAEAVESMYQDMAARHRARFRNVQILRVAEVEKKDDIRRPYIKQLLEPGLKFPLPHRRT---------KSKAWFAANRPVSFFLSLRCY
MAY10051|Rpl18a      HNMYKEFRALSRAEAAESLYQDMAARHRARFASIHILKIAEIEKSEDVKRPYIKQLMAPGLKFPLPHRRP---------RHVGTFAGQRPNTFY------
RHI10199|Rpl18a      HNMYKEYRAMSRVEAVETCYQDMAARHRARFRSVQIIRVAEVKDAD-VRRQYIKQLLTPKLSFPLPH---RIVKA--DKKHRSLFIAKRPTTFY------
RHI10200|Rpl18a-2    HNMYKEYRAMSRVEAVETCYQDMAARHRARFRSVQIIRVAEVKDAD-VRRQYIKQLLTPKLSFPLPH---RIVKA--DKKHRSLFIAKRPTTFY------
RHI10201|Rpl18a-3    HNMYKEYRAMSRVEAVETCYQDMAARHRARFRSVQIIRVAEVKDAD-VRRQYIKQLLTPKLSFPLPH---RIVKA--DKKHRALFVAKRPTTFY------
RHI10202|Rpl18a-4    HNMYKEYRAMSRVEAVDTCYQDMAARHRARFRSVQIIRVAEVKDAD-VRRQYIKQLLTPKLAFPLPH---RVVKA--DKKHRALFIAKRPTTFY------
RHI10203|Rpl18a-5    HNMYKEYRAMSRVEAVDTCYQDMAARHRARFRSVQIIRVAEVKDAD-VRRQYIKQLLTPKLSFPLPH---RIVKA--DKKHRALFIAKRPTTFY------
ARA10143|RPL18Aa     HNMYKEYRDTTLNGAVEQMYTEMASRHRVRFPCIQIIKTATVPASL-CKRESTKQFHNSKIKFPLVFRKVRPPTR----KLKTTFKANKPNLFM------
ARA10144|RPL18Ab     HNMYKEYRDTTLNGAVEQMYTEMASRHRVRFPCIQIIKTATVPAKL-CKRESTKQFHNSKIKFPLVFRKVRPPSR----KLKTTYKANKPNLFM------
ARA10145|RPL18Ac     HNMYKEYRDTTLNGGVEQMYTEMASRHRVRFPCIQIIKTATVPAKL-CKREITKQFHNSKIKFPLVFRKVRPPSR----KLKTTYKASKPNLFM------
RIC10168|RPL18Ab     HNMYKEYRDTTLNGAVEQMYTEMASRHRVRFPCIQIIKTATVHFKL-CKRDNTKQFHKSDIKFPLVYRKVRPPTR----KLKTTFKASRPNLFM------
RIC10169|RPL18Ac     HNMYKEYRDTTLNGAVEQMYTEMASRHRVRFPCIQIIKTATVHFKL-CKRDNTKQFHNGSIKFPLVYRKVRPPTR----KLKTTFKASRPNLFM------
GMA10259|LOC10052700 HNMYKEYRDTTLNGAVEHMYTEMASRHRVRHPCIQIIKTATIPAKL-CKRESTKQFHNSKIKFPLVFKKVRPPTR----KLKTTYKASRPNLFM------
GMA10261|LOC10030636 HNMYKEYRDTTLNGAVEHMYNEMASRHRVRSPCIQIIKTATIPAKL-CKRESTKQFHNSKIKFPLVFKKVRPPTR----KLKTTYKATKPNLFM------
GMA10262|LOC10050010 HNMYKEYRDTTLNGSVEAMYNEMASRHRVRSPCIQIIKTATIPAKL-CKRESTKQFHNSKIKFPLVFQKVRPPTR----KLKTTYKAKKPNLFM------
GMA10263|LOC10030617 HNMYKEYRDTTLNGAVEAMYNEMASRHRVRSPCIQIIKTATIPAKL-CKRESTKQFHNSKIKFPLVYKKVRPPTR----KLKTTYKAKKPNLFM------
GMA10264|LOC10030560 HNMYKEYRDTTLNGAVEHMYTEMASRHRVRHPCIQIIKTATIPAKL-CKRESTKQFHNSKIKFPLVFKKIRPPTR----KLKTTYKASRPNLFM------
POP10052|RPL18A      HNMYKEYRDTTLNGAVEQMYTEMASRHRVRFPCIQIIKTATIPAKL-CKRESTKQFHNSKIKFPLVFKKVRPPSR----KLKTTYKASRPNLFM------
CRE10051|RPL18A      HNMYKEYRDVTLNGSVSQMYQEMASRHRVRPSSIQIIKTATVDYHS-CKRANTKQFHNEKISFPVTQKLARPSSA----TFRTLFKANRPNVAMF-----
VOL10054|RPL18A      HNMYKEYRDVTLNGSVAQMYQEMASRHRVRPSSIQIIKTATVDYHS-CKRANTKQFHNENIKFPVTHKLSRPSNP----EFRTLFKASRPNVAMF-----
HEM10048|rpl18A      INMYKEYRDVLVCGAVEQMYMEMAGRHRAKWSSIIILRIEQLSTKE-CIRQEIKQFHKNSLKFPISHFIFQPPWD----TSLFPFKSYRPQTCLKEN---
PTR10053|RPL18A      HNMYREFRDVKLTGAVSQLYDEMAGRHRTRPRSIQIIRTAQVAAKD-LLRVNPTQFAKAKVQFPLPHRVASGKRGQK-ALSDRTYSTVRPTTFFG-----
TPS10051|Rpl18a      HNMYREYRDLKLTGAISQLYDEMAGRHRTRPRSIQIIRTATLGAGE-LKRPNGAQFAQAKVKFPLPHRVDSAKRGQK-ALSDRTFSTVRPTTYFG-----
CYA10052|RPL18A      VNMLKETRATSVAGAVENIYQEMAGRHRARAESIQILRVQETPSSQ-CKRPATLQLIDPQLRFPLPRQRQRASKQ----SLRTTFKAKLPVTTITK----
DIC10051|RPL18A      HNIYKEYRDLTRCGAVSQMYDEMASRHSARESSIHIIDIKEIAASL-TRRANTKQFHDSKIKFPLTHRIAKS---------KSTFVANRPNTFFC-----
PLA10058|RPL18A      HNMYKEFRDTTKEGAIAQLYSEMAGRHRARASSINIIRISEISSSL-VRRPHIKQLLKRRLRFPALHLPTLQKEYR------KKFASKRPSTYRM-----
TGO10051|RPL18A      HNMYKEVRDISQNGAVSQLYAEMAGRHRALPSNIQIIRVAEIKASQ-CRRAHMQQLFDSKLKLPAIRRIFPTP-K----DKKSVFCARKPTLFLH-----
GIA10051|Rpl18a      HNMYREVRETTSARAMDKVYSEMAGQCRARYHDIQIINVKEVADED-VRREKVAMFTQKGVRFPHPCPYVHVKRA----ARTARFQDRAPHVPQ------
MET10033|MJ0595      LYFRKEYKALKPEDALEILYSEFGGRYKVKRSRIKILNIEEIKPED-VTDPVLKKLVTA-----------------------------------------
PYR10049|PHS021      FKFTKEYRALKEEHVKELVYSDIGSRHKVKRRKIFIKEIREIKPEE-AEDIVVRRLSLEL----------------------------------------
SUL10057|STS167      QKVVKYVRALNEKQALEYLYSYLGSKNKVKRYNIKIEEIKEIPVEE-AKDKTVRDLAKLNKIIM------------------------------------


HUM10052|RPL18A      --
DOG10051|Rpl18a      --
MUS10051|Rpl18a      --
RAT10051|LOC290641   --
FUG10052|RPL18A      --
DAN10051|Rpl18a      --
MED10051|Rpl18a      --
CIO10051|RPL18A      --
DRO10072|RpL18A      --
MOS10052|Rpl18a      --
BEE10053|Rpl18a      --
CEL10054|rpl-20      --
BMA10051|RPL18A      --
STE10051|RPL18A      --
MBR10051|RPL18A      --
NEU10052|Rpl18a      --
GRI10051|Rpl18a      --
GRA10052|Rpl18a      --
STA10051|Rpl18a      --
YAR10052|Rpl18a      --
POM10093|RPL18A-1    --
POM10094|RPL18A-2    --
YST10091|RPL20A      --
YST10092|RPL20B      --
CIN10052|Rpl18a      --
NEA10051|Rpl18a      IG
MAY10051|Rpl18a      --
RHI10199|Rpl18a      --
RHI10200|Rpl18a-2    --
RHI10201|Rpl18a-3    --
RHI10202|Rpl18a-4    --
RHI10203|Rpl18a-5    --
ARA10143|RPL18Aa     --
ARA10144|RPL18Ab     --
ARA10145|RPL18Ac     --
RIC10168|RPL18Ab     --
RIC10169|RPL18Ac     --
GMA10259|LOC10052700 --
GMA10261|LOC10030636 --
GMA10262|LOC10050010 --
GMA10263|LOC10030617 --
GMA10264|LOC10030560 --
POP10052|RPL18A      --
CRE10051|RPL18A      --
VOL10054|RPL18A      --
HEM10048|rpl18A      --
PTR10053|RPL18A      --
TPS10051|Rpl18a      --
CYA10052|RPL18A      --
DIC10051|RPL18A      --
PLA10058|RPL18A      --
TGO10051|RPL18A      --
GIA10051|Rpl18a      --
MET10033|MJ0595      --
PYR10049|PHS021      --
SUL10057|STS167      --