CLUSTAL W (2.1) Multiple Sequence Alignments
HUM10053|RPL19       --MSMLRLQKRLASSVLRCGKKKVWLDPNETNEIANANSRQQIRKLIKDGLIIRKPVTVHSRARCRKNTLAR-RKGRHMGIGKRKGTANARMPEKVTWMR
DOG10052|Rpl19       --MSMLRLQKRLASSVLRCGKKKVWLDPNETNEIANANSRQQIRKLIKDGLIIRKPVTVHSRARCRKNTLAR-RKGRHMGIGKRKGTANARMPEKVTWMR
MUS10052|Rpl19       --MSMLRLQKRLASSVLRCGKKKVWLDPNETNEIANANSRQQIRKLIKDGLIIRKPVTVHSRARCRKNTLAR-RKGRHMGIGKRKGTANARMPEKVTWMR
RAT10052|Rpl19       --MSMLRLQKRLASSVLRCGKKKVWLDPNETNEIANANSRQQIRKLIKDGLIIRKPVTVHSRARCRKNTLAR-RKGRHMGIGKRKGTANARMPEKVTWMR
CHK10054|Rpl19       ----MLRLQKRLASSVLCCGKKKVWLDPNETNEIANANSRQQIRKLIKDGLIIRKPVTVHSRARCRKNTLAR-RKGRHMGIGKRKGTANARMPEKVTWMR
FUG10053|RPL19       --MSMLRLQKRLASSVLRCGKKKVWLDPNETNEIANANSRQQIRKLVKDGLIIRKPVTVHSRARCRKNTLAR-RKGRHMGIGKRKGTANARMPEKLCWMR
DAN10052|Rpl19       --MSMLRLQKRLASSVLRCGKKKVWLDPNETNEIANANSRQQIRKLVKDGLIIKKPVTVHSRARCRKNTLAR-RKGRHMGVGKRKGTANARMPEKLCWMR
MED10052|Rpl19       --MSMLRLQKRLASSVLRCGKKKVWLDPNETNEIANANSRQQIRKLVKDGLIIRKPVTVHSRARCRKNTLAR-RKGRHMGYGKRKGTANARMPEKLSWMR
CIO10052|RPL19       --MSTLRLQKRLAATVMKCGKNKIWLDPNESSMISNANSRQNVRKLIKDGLIIRKPVAVHSRARVRKNTIAR-RKGRHTGRGKRKGTANARMPEKVVWIR
DRO10073|RpL19       --MSSLKLQKRLAASVLRCGKKKVWLDPNEINEIANTNSRQNIRKLIKDGLIIKKPVVVHSRYRVRKNTEAR-RKGRHCGFGKRKGTANARMPTKLLWMQ
MOS10053|Rpl19       --MSSLKLQKRLAASVMRCGKKKVWLDPNEINEIGNTNSRQNIRKLIKDGLIIKKPVVVHSRYRVRKNTIAR-RKGRHCGYGKRKGTANARMPQKLLWMN
BEE10054|Rpl19       --MSSLKLQKRLAASVMRCGKKKVWLDPNEINEIANTNSRQSIRKLIKDGLIIKKPVAVHSRARVRKNTEAR-RKGRHCGFGKRKGTANARTPQKDLWIQ
CEL10055|rpl-19      --MSNLRLQKRLASAVLKCGKHRVWLDPNEVSEISGANSRQSIRRLVNDGLIIRKPVTVHSRFRAREYEEAR-RKGRHTGYGKRRGTANARMPEKTLWIR
BMA10052|RPL19       --MSGLRLQKRLASDVLKCGKKKVWLDPNEINEISNANSRQNIRRLVKDGLIIRKPVAVHSRYRARKNLEAR-RKGRHMGHGKRRGTQNARMPEKILWIR
STE10052|RPL19       --MSTLRLQKRLAASLLKCGKKKIWLDPNECNEIANANSRQNVRKLIKDGLIIKKPEIVHSRARVRKADEAR-SKGRHSGHGKRKGTANARMPQKTIWIR
MBR10052|RPL19       --MVVLRLQKRLAASVLKCGKRKIWLDPNETQDISHANSRQQVKKLIADGYIIRQPQVVHSRSRALRHAAAV-RKGRHTGHGKRKGTANARMPVKVLWMR
NEU10053|Rpl19       --MVNLRTQKRLASSVLGVGQRKIWLDPNEVSEISNANSRQTIRKLVADGLIIKKPVTMHSRSRARELNLAR-RIGRHRGFGKRKGTADARMPEQVLWMR
GRI10052|Rpl19       --MVNLTTQKRLAASVLDCGKNKIWLDPNEVSEISNANSRQTIRKLVQDGLIIKKPVTMHSRARARELNLAR-RIGRHRGFGKRKGTADARMPTQVVWMR
GRA10053|Rpl19       --MVNLRTQKRLASAVIGCGERKIWLDPNEQSEISNANSRQTIRKLISDGLIIRKPVTQHSRSRARELNLAR-REGRHRGYGKRKGTADARMPSQVLWMR
STA10052|Rpl19       --MVNLRTQKRLAASVVGCGKRKIWLDPNETSEIANANSRQTIRKLVQDGLIIRKPVTMHSRARARALTAAR-RIGRHRGFGKRKGTADARMPSQILWMR
YAR10053|Rpl19       --MANLKTTKRLAASVLGVGKRKIWLDPQELTDIANANSRQQVRKLVSDGLIVRKPNAMHSRSRTRALAEAK-RAGRHTGFGKRKGTANARMPEQVLWMR
POM10091|RPL19-1     --MANLRTQKRLAASVLKCGKRKVWMDPNEISEISNANSRQNVRKLIKDGLVIRKPNLMHSRFRIRKTHAAK-RLGRHTGYGKRKGTAEARMPSAVVWMR
POM10092|RPL19-2     --MANLRTQKRLAASVLKCGKRKVWMDPNEISEISNANSRQNIRKLVKDGLVIRKPNLMHSRFRIRKTHAAK-RLGRHTGYGKRKGTAEARMPSTVVWMR
YST10093|RPL19A      --MANLRTQKRLAASVVGVGKRKVWLDPNETSEIAQANSRNAIRKLVKNGTIVKKAVTVHSKSRTRAHAQSK-REGRHSGYGKRKGTREARLPSQVVWIR
YST10094|RPL19B      --MANLRTQKRLAASVVGVGKRKVWLDPNETSEIAQANSRNAIRKLVKNGTIVKKAVTVHSKSRTRAHAQSK-REGRHSGYGKRKGTREARLPSQVVWIR
CIN10053|Rpl19       --MVNLRSQKRLAAAVSGAGKRKIWLDPAEQAEIGNANSRTHVKKLIKDGRIIVKPTVIHSRARTRANLASK-RKGRHTGTGKRKGTADARFPAKVQWMR
NEA10052|Rpl19       --MVNLRQQKRLAASVAGVGKRKIWLDPQEAAEIGQANSRSGVRKLLKDGHIIVKPTVIHSRARAREHAAAK-RAGRHTGFGKRKGTAEARMPTKVQWLR
MAY10052|Rpl19       --MVNLRTQKRLAASVLGCGKRKVWLDPAEQNDIGNANSRANIRKLIRDGQIIRKPVVGGSRSRARATAAAK-RAGRGTGQGHRKGSSEARMPTKVMWMR
RHI10204|Rpl19       --MVSLVVQKRLAASVLKCGQRKIWLDPNEVNEISNANSRANIRKLVKDGLIIRKPQIAQSRFRVLERAAAK-RNGRHMGYGKRKGTADARMSSQVIWMR
RHI10205|Rpl19-2     --MVNLIVQKRLAASVLKCGQRKIWLDPNEVSEISNANSRANIRKLVKDGLIIRKPQIAQSRFRVLERAAAK-RNGRHMGYGKRKGTADARMSSQVIWMR
RHI10206|Rpl19-3     --MVSLVVQKRLAASVLKCGKRKIWLDPNEVNEISNANSRANIRKLVKDGLIIRKPEIAQSRFRVLERAAANGRNGRHMGYGKRKGTADARMSSQVIWMR
RHI10207|Rpl19-4     --MVSLVVQKRLAASVLKCGKRKIWLDPNEVNEISNANSRANIRKLVKDGLIIRKPEIAQSRFRVLERAAAK-RNGRHMGYGKRKGTADARMSSQVIWMR
ARA10146|RPL19A      --MVSLKLQKRLAASVMKCGKGKVWLDPNESSDISMANSRQNIRKLVKDGFIIRKPTKIHSRSRARKMKIAK-MKGRHSGYGKRKGTREARLPTKVLWMR
ARA10147|RPL19B      --MVSLKIQKRLAASVMKCGKGKVWLDPNESGDISMANSRQNIRKLVKDGFIIRKPTKIHSRSRARALNEAK-RKGRHSGYGKRKGTREARLPTKILWMR
ARA10148|RPL19C      --MVSLKLQKRLASSVLKCGKRKVWLDPNEGSDISMANSRQNIRKLVKDGFIIRKPTKIHSRSRARQLNIAK-RKGRHSGYGKRKGTREARLPTKVLWMR
RIC10171|RPL19A      --MVSLKLQKRLAASVLKCGKGKVWLDPNEVNEISMANSRQNIRKLVKDGFIIKKPQKIHSRSRARRAHEAK-QKGRHSGYGKRRGTREARLPTKILWMR
RIC10172|RPL19B      --MVSLKLQKRLASSVLKCGKGKVWLDPNEVNEISMANSRQNIRKLVKDGFIIKKPQKIHSRSRARRAHEAK-QKGRHSGYGKRRGTREARLPTKILWMR
GMA10267|LOC10049987 --MVSLKLQKRLAASVLKCGRGKVWLDPNEVNEISMANSRQNIRKLVKDGFIIRKPTKIHSRSRARRMKEAK-RKGRHSGYGKRKGTREARLPTKILWMR
GMA10268|LOC10081888 --MVSLKLQKRLAASVLKCGKGKVWLDPNEVNEISMANSRQNIRKLVKDGFIIRKPTKIHSRSRARRMKEAK-RKGRHSGYGKRKGTREARLPTKILWMR
GMA10269|LOC10050044 --MVSLKLQKRLAASVLKCGRGKVWLDPNEVNEISMANSRQNIRKLVKDGFIIRKPTKIHSRSRARRMKEAK-KKGRHSGYGKRKGTREARLPTKILWMR
GMA10270|LOC10050044 --MVSLKLQKRLAASVLKCGRGKVWLDPNEVNEISMANSRLNIRKLVKDGFIIRKPTKIHSRSRARRMKEAK-RKGRHSGYGKRKGTREARLPTKILWMR
GMA10271|LOC10052750 --MVSLKLQKRLAASVLKCGRGKVWLDPNEVNEISMANSRQNIRKLVKDGFIIRKPTKIHSRSRARRMKEAK-RKGRHSGYGKRKGTREARLPTKILWMR
GMA10272|LOC10049988 --MVSLKLQKRLAASVLKCGRGKVWLDPNEVNEISMANSRQNIRKLVKDGFIIRKPTKIHSRSRARRMKEAK-RKGRHSGYGKRKGTREARLPTKILWMR
GMA10273|LOC10052727 --MVSLKLQKRLSASVLKCGRGKVWLDPNEVNEISMANSRQNIRKLVKDGFIIRKPTKIHSRSRARRMKEAK-RKGRHSGYGKRKGTREARLPTKILWMR
GMA10274|LOC10049992 --MVSLKLQKRLAASVLKCGRGKVWLDPNEVNEISMANSRQNIRKLVKDGFIIRKPTKIHSRSRARRMKEAK-RKGRHSGYGKRKGTREARLPTKILWMR
POP10053|RPL19       --MVSLKLQKRLSASVLKCGKGKVWLDPNEVNEISMANSRQNIRKLVKDGFIIRKPTKIHSRSRARRMKEAK-RKGRHSGYGKRKGTREARLPTKVLWMR
CRE10052|RPL19       --MVSLKLQKRLAASVLNCGLRKVWLDPNEVNEISMANSRQNVRKLIKDGLIFRKQPVIHSRDRARRSAEAK-AKGRHTGYGKRRGTREARLPEKVMWIR
VOL10055|RPL19       --MVSLKLQKRLAASVLNCGLRKVWLDPNEVNEISMANSRQNVRKLIKDGLVFRKQPIIHSRDRARRSAEAK-AKGRHTGYGKRRGTREARLPQKVMWIR
HEM10049|rpl19       --MQISKVQTRLASSILQCGKRKIWMDPNEINEISLSDKRKTIRKLIQNGIILKKNPKLHSTNRKKFHLEAK-KKGKHKGIGKRKGTSNARSSERVKWHF
PTR10054|RPL19       -MGVSLKLQKRLAASVLKCGKRKIWLDPNEINEIALANSRRNIQKLHRDGLIIKKPSVVHSRARVQLRNEAK-RKGRHTGTGKRRGTANARLPFKVIWMR
TPS10052|Rpl19       --MVSLKLQKRLAASVLKCGKRKIWLDPNEINEISLANSRRNIARLEKDGLIMKKPAVVHSRSRVNARLEAK-RKGRHTGIGKRRGTANARLPFKVIWMR
CYA10053|RPL19       MVTTSIKLQKRLAAAVAGVGKKKIWADPAEIEKIALANSRQSVRKLLRDGVLVRKPPAMHSRARVRERLEAK-RKGRHTGPGKRKGTRDARLPQRVVWMR
DIC10052|RPL19       --MVSLKLQKRLAASILKCGKGRVWIDPNEIADVAMANSRDNVRRLIATGFIMRKPVVVHSRSRAREHNAAK-RLGRHRGAGNRLGTREARLPSKILWIR
PLA10059|RPL19       ---MSLTLQKRLAASVLKCGKNKIWMDPNEISEISLANSRFSIRKLYKEGLILKKPQKVHSRARVRLYKLAK-RKGRHMGIGKRKGTKNARTNQKTLWIK
TGO10052|RPL19       ---MSLQLQKRLAASILKCGRRRVWMDPNEASDISMANSRFSIRKLVKDNLIIRKAVAVHSRYRVRLYHEAK-RAGRHMGKGKRKGTREARLPAKVLWMR
GIA10052|Rpl19       --MANLRLQKRLAADVLKCGKRRVRFNPAHEKYIEQASSREAIRSLIESKIIAKLDIKGSSRGRIRARHAAK-RLGRHSGHGKRRGTREARMPSKTLWIQ
HAL10048|VNG1713G    --MSDLSAQKRLAADVLDVGENRVWFDPDAQSEIADAITREDIRELVADGTIDAEDTQGNSRGRARERDAKE-SYGHKKGAGSRKGKAGARQNEKREYVA
MET10044|MJ0473      VIIMDVSVQRRMAAEILKCGIERVWIDPTQLDRVKMAMSKDDIRALIKEGVIKKKQKKGISSARVKKLKEQR-KKGRRRGPGSRRGAAGARTPPKERWMA


HUM10053|RPL19       RMRILRRLLRRYRESKKIDRHMYHSLYLKVKGNVFKNKRILMEHIHKLKADKARKKLLADQAEARRSKTKEARKRREERLQAKKEEIIKTLSKEEETKK-
DOG10052|Rpl19       RMRILRRLLRRYRESKKIDRHMYHSLYLKVKGNVFKNKRILMEHIHKLKADKARKKLLADQAEARRSKTKEARKRREERLQAKKEEIIKTLSKEEETKK-
MUS10052|Rpl19       RMRILRRLLRRYRESKKIDRHMYHSLYLKVKGNVFKNKRILMEHIHKLKADKARKKLLADQAEARRSKTKEARKRREERLQAKKEEIIKTLSKEEETKK-
RAT10052|Rpl19       RMRILRRLLRRYRESKKIDRHMYHSLYLKVKGNVFKNKRILMEHIHKLKADKARKKLLADQAEARRSKTKEARKRREERLQAKKEEIIKTLSKEEETKK-
CHK10054|Rpl19       RMRILRRLLRRYRESKKIDRHMYHSLYLKVKGNVFKNKRILMEHIHKLKADKARKKLLADQAEARRSKTKEARKRREERLQAKKEEIIKTLSKEEETKK-
FUG10053|RPL19       RMRILRRLLRRYRESKKIDRHMYHSLYLKAKGNVFKNKRILMEHIHKLKADKARKKLLADQAEARRSKTKEARKRREERLQAKKEEIIKNLSKEEETTKK
DAN10052|Rpl19       RMRILRRLLRRYREAKKIDRHMYHSLYLRAKGNVFKNKRILMEHIHKLKADKARKKLLADQAEARRTKTREARKRREERQQAKKEEIIKTLSKEDETKK-
MED10052|Rpl19       RMRILRRLLRRYRESKKIDRHMYHSLYLKAKGNVFKNKRILMEHIHKLKADKARKKLLADQAEARRTKTKEARKRREERLLAKKEEIIKNLSKEEETTKK
CIO10052|RPL19       RMRVLRRLLRKYRESKKIDKHMYHTLYLKAKGNGFKNKRILMEHIHKQKAKQSRAKMFSDQASARRLKNKEGRRRREERIALKKKEMLSALAKEDEATKK
DRO10073|RpL19       RQRVLRRLLKKYRDSKKIDRHLYHDLYMKCKGNVFKNKRVLMEYIHKKKAEKQRSKMLADQAEARRQKVREARKRREERIATKKQELIALHAKEDEIAAK
MOS10053|Rpl19       RMRVLRRLLKKYREAKKIDRHLYHDLYMRAKGNVFKNKRILIEHIHKRKAEKARSKMLSDQAEAKRTKVREARRRREERIATKRQELLQTIAKEEETAQH
BEE10054|Rpl19       RMRVLRRLLKKYRETKKIDRHLYHSLYMKAKGNVFKNKRVLMEFIHKKKAEKARAEMLSDQAEARRTKVREARKRRAERIATKKQELLQSYQREDEAAAA
CEL10055|rpl-19      RMRVLRNLLRRYRDAKKLDKHLYHELYLRAKGNNFKNKKNLIEYIFKKKTENKRAKQLADQAQARRDKNKESRKRREERQVVKRAELLRKISQSEKVIAG
BMA10052|RPL19       RMRVLRHLLKRYREAKKIDKHLYHDLYLRAKGNAFKNKRNLMEFIFKRKTENARSKQLAEQAEARRAKNKESRKRREQRLILKRAEALRKISENEKEAVA
STE10052|RPL19       RMRVLRRLLRKYREAKKIDNHMYHSLYMKSKGNVFKNKRVLMEYIHKKKAEKARSKLLSDQAEARRNKNKAAKQRRDDRMEQKRKDMLSAYAKEEEAAK-
MBR10052|RPL19       RQRVLRRLLRKYRATKKIDNHLYHELYMRSKGNVFKNKRVLMEYIHKRKAEDSRKKLLSDQAEARRQRVRAARERRADRVQKRQQELISEAVNAEKKK--
NEU10053|Rpl19       RQRVLRRLLVKYRASGKIDKHLYHELYHLAKGNTFKHKRALVEHIHRAKAEKAREKAIKEEMDAKRARTKAARERKLERQAAKRNALAGEEEESK-----
GRI10052|Rpl19       RQRVLRRLLVKYRASGKIDKHLYHELYHSAKGNTFKHKRALVEHIHRAKAEKQRERLLKDEMDAKRAKTKAARERKLERQAAKRNALAGEAEE-------
GRA10053|Rpl19       RLRVLRRLLVKYRASGKIDKHLYHELYHSSKGNAFKHKRALVEHIHRAKAEKARETALQEEMDAKRAKNKAARERKQERAAAKRNALLAEE---------
STA10052|Rpl19       RLRVLRRLLVKYRAAGKIDKHLYHELYHLSKGNTFKHKRALVEHIHKAKAEKARERVIKEEMDAKRAKTKAARERRQERVQQKRAAQIGDEE--------
YAR10053|Rpl19       RQRVIRRLLSKYREQGKIDKHLYHELYKLAKGNTFKHKRAVVEHVIKAKAEATREKALKDEAEARRVKNRAARERRAARIAEKREQLLAEN---------
POM10091|RPL19-1     RQRVLRRLLRKYRESGKIDKHLYHTLYLEAKGNTFKHKRALIEHIQRAKAEANRTKLIQEQQDARRARAKAARQRRAKAVEEKREQLYTAAEKIEE----
POM10092|RPL19-2     RQRVLRRLLRKYRESGKIDKHLYHTLYLEAKGNTFKHKRALIEHIQRAKAEANRTKLIQEQQDARRARAKAARQRRAKAVEEKREQIYTAAEKIEE----
YST10093|RPL19A      RLRVLRRLLAKYRDAGKIDKHLYHVLYKESKGNAFKHKRALVEHIIQAKADAQREKALNEEAEARRLKNRAARDRRAQRVAEKRDALLKEDA--------
YST10094|RPL19B      RLRVLRRLLAKYRDAGKIDKHLYHVLYKESKGNAFKHKRALVEHIIQAKADAQREKALNEEAEARRLKNRAARDRRAQRVAEKRDALLKEDA--------
CIN10053|Rpl19       RQRVLRRLLRKYREAGKIDKHLYHVLYQKAKGNVFKNKRVLMEYIHKAKAEKTRTKILADQMEARRLKNKAIRERRAARLAEKRQGITAVEQEDAQE---
NEA10052|Rpl19       RMRVLRRLLKKYREAGKIDKHMYHTLYLEAKGNRFKNKRVLMEHIHREKAEKLRTKHLAEQQEARRVKNKAMRERRANRLAEKRQGIHEVEQEEAKE---
MAY10052|Rpl19       RQRVLRRLLRKYRESGKIDKHLYHELYLKSKGNVFKNKRVLMEHIHKAKAEAARSKHLADQMEARRMRNKAMRERRAQRVLEKRAAIIAVENEAEEKK--
RHI10204|Rpl19       RMRVLRRLLAKYREAGKIDKHLYHQLYLKSKGNGFKNKRVLMEHIHKAKAEKVRAKTLAEQADVLRAKNKALRERRANKKAEKVEA--------------
RHI10205|Rpl19-2     RMRVLRRLLAKYREAGKIDKHLYHQLYLKSKGNGFKNKRVLMEHIHKAKAEKVRAKTLAEQADVLRAKNKALRERRANKKADKAVA--------------
RHI10206|Rpl19-3     RMRVLRRLLAKYREAGKIDKHLYHQLYLKSKGNGFKNKRVLMEHIHKAKAEKVRAKTLAEQADVLRAKNKALRERRANKKAEKVEA--------------
RHI10207|Rpl19-4     RMRVLRRLLAKYREAGKIDKHLYHQLYLKSKGNGFKNKRVLMEHIHKAKAEKVRAKTLAEQADVLRAKNKALRERRANKKAEKVEA--------------
ARA10146|RPL19A      RMRVLRRLLKKYRETKKIDKHMYHDMYMRVKGNVFKNKRVLMESIHKSKAEKAREKTLSDQFEAKRAKNKASRERKHARREERLAKGPGG--DVAPVAAP
ARA10147|RPL19B      RMRVLRRFLSKYRESKKIDRHMYHDMYMKVKGNVFKNKRVLMESIHKMKAEKAREKTLADQFEAKRIKNKASRERKFARREERLAQGPGGGET-------
ARA10148|RPL19C      RMRVLRRLLKKYRETKKIDRHMYHDMYMKVKGNVFKNKRVLMESIHKSKAEKAREKTLSDQFEAKRAKNKASRERKHARREERLAKGPGG--DIP-----
RIC10171|RPL19A      RMRVLRRLLRKYREAKKIDKHMYHDMYMKVKGNMFKNKRVLMESIHKSKAEKAREKTLSDQFEAKRAKSKASRERKIARREERLAQGPREPAAPAAAAPA
RIC10172|RPL19B      RMRVLRRLLRKYREAKKIDKHMYHDMYMKVKGNMFKNKRVLMESIHKSKAEKAREKTLSDQFEAKRAKSKASRERKIARRDERLAQGPREPAAP--AVPA
GMA10267|LOC10049987 RMRVLRRLLRKYRESKKIDKHMYHDMYMKVKGNVFKNKRVLMESIHKSKAEKAREKTLSDQFEAKRAKNKASRERKIARREERLAQGPGEKVSAASSAPA
GMA10268|LOC10081888 RMRVLRRLLRKYRESKKIDKHMYHDMYMKVKGNVFKNKRVLMESIHKSKAEKAREKTLSDQFEAKRAKNKASRERKNARREERLAQGPGERPSAAQTTTP
GMA10269|LOC10050044 RMRVLRRLLRKYRESKKIDKHMYHDMYMKVKGNVFKNKRVLMESIHKSKAEKAREKTLSDQFEAKRAKNKASRERKLARREERLAQGPIDKTSTAPSAPA
GMA10270|LOC10050044 RMRVLRRLLRKYREAKKIDKHMYHDMYMKVKGNVFKNKRVLMESIHKSKAEKAREKTLSDQFEAKRAKNKASRERKIARREERLAQGPGEKPSAAPSAPS
GMA10271|LOC10052750 RMRVLRRLLRKYRESKKIDKHMYHDMYMKVKGNVFKNKRVLMESIHKSKAEKAREKTLSDQFEAKRAKNKASRERKIARREERLAQGPGEKVSAAPSATA
GMA10272|LOC10049988 RMRVLRRLLRKYREAKKIDKHMYHDMYMKVKGNVFKNKRVLMESIHKSKAEKAREKTLSDQFEAKRAKNKASRERKNARREERLAQGPGEKPSAAPSAPS
GMA10273|LOC10052727 RMRVLRRLLRKYRESKKIDKHMYHDMYMKVKGNVFKNKRVLMESIHKSKAEKAREKTLSDQFEAKRAKNKASRERKIARREERLAQGPVDKSFTAPSAPA
GMA10274|LOC10049992 RMRVLRRLLRKYRESKKIDKHMYHDMYMKVKGNVFKNKRVLMESIHKSKAEKAREKTLSDQFEAKRAKNKASRERKNARREERLAQGPGERPPAAQTATP
POP10053|RPL19       RMRVLRRLLRKYRESKKIDKHMYHDMYMKVKGNVFKNKRVLMESIHKSKAEKAREKTLSDQFEAKRAKNKASRERKFARREERLAQGPGAEKPVVAPPAA
CRE10052|RPL19       RLRVLRRLLKKYRDSKKIDKHLYHDLYMKVKGNVFKNKRVLMEAVHKQKAEKVREKTIADQFEARRAKNKAARERKATRREERLAAGLHLEAPATKPAPA
VOL10055|RPL19       RLRVLRRLLKKYRDSKKIDKHLYHDLYMKVKGNVFKNKRVLMEAVHKQKAEKVREKTIADQFEARRAKNKAARERKATRREERLAAGLHLEAPATKPLPA
HEM10049|rpl19       KQKVFRHLLKKYRTSEKIDKYLYRQLYLKSKGNAFKNKRVLLDYIHSAKSEYNRKKIKNERQLARHNKKTAIVKNRISKFQDKMKKIYQDKK--------
PTR10054|RPL19       RSRVLRRLLKKMRDAKKIDKHIYHSLYMLAKGNQFKNKRVLIETIHDMKAVKAKETALTVQAEARKGRAKSRLERRAAREAKKMADNEAAQQAS------
TPS10052|Rpl19       RIRVLRRLLHKMRDAKKIDKHIYHTLYLHAKGNQFKNKRVLLETIHTMKAEKAQTKALADQAEAKKSRARARVARRAAKEAKGKEDQ-------------
CYA10053|RPL19       RQRVLRRLLRKYRAQGKIDKHLYHELYLRCKGNVFKNKRVLMEHIHRAKAEKAREKAISEQLEARRMKNKLLRERRANRAEERRLKEAGISMETTEREGE
DIC10052|RPL19       RIRVLRRLLKKYREAKKIDKHSYRELYLKAKGNVFKNKRTLIEYIVKSKTEKLREKLIQDQAQARRNKNKSIKDRRAAKSAAKEIVSSN-----------
PLA10059|RPL19       RQRVLRRLLKRLRDSKKVDRHLYHSFYLKCKGNQFKNKRTLIEAIQREKNETLKKKAIADQLEAKRLKAQVLRNKRKLKKDKEVVA--------------
TGO10052|RPL19       RQRVLRRLLKKYRDSKKIDKHMYHSMYMRCKGNQFKNKRVLIEAIHNEKNLKLKEKALQEQLEARKSKAAAQKEKRRMKELKKEADSPASA---------
GIA10052|Rpl19       RQRVLRRLLSRYRDDEKIDRHLYETLYAKAKGNMFKNKRVLLEHIVGMQKEQELEKKKKEELEQRRKKAEQRCKERAEKVAANRLAFAQTGIFTEKTNK-
HAL10048|VNG1713G    GIRAQRQQLRELRDDGTLSPAQYREMYNMANGGEFDSVRRLTNYVEENYGDS------------------------------------------------
MET10044|MJ0473      TIRALRKTLKQLRDSGKIDRKVYRKLYRMAKGGAFRSRSHLFLYMREHELLK------------------------------------------------


HUM10053|RPL19       --------------------
DOG10052|Rpl19       --------------------
MUS10052|Rpl19       --------------------
RAT10052|Rpl19       --------------------
CHK10054|Rpl19       --------------------
FUG10053|RPL19       --------------------
DAN10052|Rpl19       --------------------
MED10052|Rpl19       --------------------
CIO10052|RPL19       E-------------------
DRO10073|RpL19       AATAGH--------------
MOS10053|Rpl19       VAATGKK-------------
BEE10054|Rpl19       QKK-----------------
CEL10055|rpl-19      K-------------------
BMA10052|RPL19       SKETKESKLVEK--------
STE10052|RPL19       --------------------
MBR10052|RPL19       --------------------
NEU10053|Rpl19       --------------------
GRI10052|Rpl19       --------------------
GRA10053|Rpl19       --------------------
STA10052|Rpl19       --------------------
YAR10053|Rpl19       --------------------
POM10091|RPL19-1     --------------------
POM10092|RPL19-2     --------------------
YST10093|RPL19A      --------------------
YST10094|RPL19B      --------------------
CIN10053|Rpl19       --------------------
NEA10052|Rpl19       --------------------
MAY10052|Rpl19       --------------------
RHI10204|Rpl19       --------------------
RHI10205|Rpl19-2     --------------------
RHI10206|Rpl19-3     --------------------
RHI10207|Rpl19-4     --------------------
ARA10146|RPL19A      APAATPAPTAAVPKKKSKK-
ARA10147|RPL19B      TTPAGAPQQPEVTKKKSKK-
ARA10148|RPL19C      -AAAPPAQTAEVPAKKSKK-
RIC10171|RPL19A      QTAAAPKKAKK---------
RIC10172|RPL19B      QTAAAPKKYKK---------
GMA10267|LOC10049987 APASQPAQAPKKSKK-----
GMA10268|LOC10081888 ATASQPAQALKKSKK-----
GMA10269|LOC10050044 ATAPQSTQAPKKFKK-----
GMA10270|LOC10050044 ATASQPAQASKKSKK-----
GMA10271|LOC10052750 ATASQPAQAPKKSKK-----
GMA10272|LOC10049988 AIASLPAQASKKSKK-----
GMA10273|LOC10052727 ATVPQSAQAPKKSKK-----
GMA10274|LOC10049992 ATASQPPRASKKSKK-----
POP10053|RPL19       PTAPQPAQGSKKSKK-----
CRE10052|RPL19       QKK-----------------
VOL10055|RPL19       PKK-----------------
HEM10049|rpl19       --------------------
PTR10054|RPL19       --------------------
TPS10052|Rpl19       --------------------
CYA10053|RPL19       TASRSRRRRGRRDEALAADS
DIC10052|RPL19       --------------------
PLA10059|RPL19       --------------------
TGO10052|RPL19       --------------------
GIA10052|Rpl19       --------------------
HAL10048|VNG1713G    --------------------
MET10044|MJ0473      --------------------