CLUSTAL W (2.1) Multiple Sequence Alignments
HAL10016|VNG1105G    ---------------MADNDIEEAVARAL--EDAPQRNFRETVDLAVNLRDLDLNDPSQRVDEGVVLPSGTGQETQIVVFADGETAVRADDVA-DDVLDE
MET10026|MJ0510      --MLFVKYKKERRMTMDREALLQAVKEAR--ELAKPRNFTQSFEFIATLKEIDMRKPENRIKTEVVLPHGRGKEAKIAVIGTGDLAKQAEELG-LTVIRK
PYR10015|PH2000      ----------MSRMAFDRQKIVEAVKEAK--ARAKPRNFTQSVEVAVNLKDIDLKRPENRFKLEVVLPHGRGKDVKIAVIADGAVAEAARRLG-LDVISS
THE10021|TTHA0246    -MPKHGKRYRALLEKVDPNKVYTIDEAARLVKELATAKFDETVEVHAKLG-IDPRRSDQNVRGTVSLPHGLGKQVRVLAIAKGEKIKEAEEAGADYVGGE
SYN10023|sll1744     MTKKLSKRMQAAIAKVDDSKLYSPLEAMELLKETATAKFDETAEAHIRLG-IDPKYSDQQIRTTVSLPKGTGQTVRVAVLARGEKVKEATDAGADIAGSE
BAC10022|Bsu0103     -MAKKGKKYVEAAKLVDHSKAYDVSEAVALVKKTNTAKFDATVEVAFRLG-VDPSKNHQQIRGAVVLPNGTGKTQRVLVFAKGEKAKEAEAAGADFVGDT
ECO10022|rplA        -MAKLTKRMRVIREKVDATKQYDINEAIALLKELATAKFVESVDVAVNLG-IDARKSDQNVRGATVLPHGTGRSVRVAVFTQGANAEAAKAAGAELVGME
SUL10016|ST1367      ----------VKNMLASKDSLVEALKVALNPENNPKRNFTQSVELIVTFKGIDMKKGELKLREIVPLPKEPSKPRKVLVIPAFQQIESAKKAEPNVLLTK


HAL10016|VNG1105G    DDLSDLADDTDAAKDLADETDFFVAEAPMMQDIAGALGQVLGPRGKMPTPLQ-PDDDVVDTVNRMKNTVQIRSRDRR--TFHTRVGAEDMSAEDIASNID
MET10026|MJ0510      EEIEELGKNKRKLRKIAKAHDFFIAQADLMPLIGRYMGVILGPRGKMPKPVP-ANANIKPLVERLKKTVVINTRDKP--YFQVLVGNEKMTDEQIVDNIE
PYR10015|PH2000      AELEEIAKSPRQARKLAKKYDFFIAEAPLMPKIGRYLGRYLGPRNKMPVVVPPTMTNIEPIVEKLKKTVRIQLKDNP--VVHAPVGTEKMSDEQLAENIE
THE10021|TTHA0246    EIIQKILDG-------WMDFDAVVATPDVMGAVGSKLGRILGPRGLLPNPKAGTVGFNIGEIIREIKAGRIEFRNDKTGAIHAPVGKASFPPEKLADNIR
SYN10023|sll1744     ELIEEIQKG-------MMDFDVLIATPDMMPKIA-RLGKQLGPRGLMPSPKGGTVTADLAAAVNEFKAGKLEFRADRTGIVHVMFGKASFSADDLLANLK
BAC10022|Bsu0103     DYINKIQQG-------WFDFDVIVATPDMMGEVG-KIGRVLGPKGLMPNPKTGTVTFEVEKAIGEIKAGKVEYRVDKAGNIHVPIGKVSFEDEKLVENFT
ECO10022|rplA        DLADQIKKG-------EMNFDVVIASPDAMRVVG-QLGQVLGPRGLMPNPKVGTVTPNVAEAVKNAKAGQVRYRNDKNGIIHTTIGKVDFDADKLKENLE
SUL10016|ST1367      EELQKLQGQKRAIKKLARQNDWFLVAQDSMALVGRILGPALGPRGKFPTPLP-NAADITEYILRFKRSTLVKTKDQP--HVQVFIGTEDMKPEDLAENAL


HAL10016|VNG1105G    VIMRRLHANLEK--GPLNVDSVYVKTTMGPAVEVA------------
MET10026|MJ0510      AVLNVVAKKYEK--GLYHIKDAYVKLTMGPAVKVKKEKAKKK-----
PYR10015|PH2000      AVLNAIIGKLER--GENQIRSVYVKTTMGPAVRVEG-----------
THE10021|TTHA0246    AFIRALEAHKPEGAKGTFLRSVYVTTTMGPSVRINPHS---------
SYN10023|sll1744     ALQETIDRNRPSGAKGRFWRTVFVSSSMGPSIPVDINALRDLKFEDN
BAC10022|Bsu0103     TMYDTILKAKPAAAKGVYVKNVAVTSTMGPGVKVDSSTFNVK-----
ECO10022|rplA        ALLVALKKAKPTQAKGVYIKKVSISTTMGAGVAVDQAGLSASVN---
SUL10016|ST1367      AVLNTIENKAKV--EAN-LRAIYVKTTMGKIVKVELKK---------