CLUSTAL W (2.1) Multiple Sequence Alignments
THE10038|TTHA0553    MPRAKTGVVRRRKHKKILKLAKGYWGLRSKSFRKARETLFAAGNYAYAHRKRRKRDFRRLWIVRINAACRQHGLNYSTFIHGLKKAGIEVDRKNLADLAV
SYN10040|sll0767     MTRVKRGNVARKRRKKILKLAKGFRGSHSKLFRTANQQVMKALRNAYRDRRKRKRDFRRLWITRINAAARQEGMSYSKLTGQLKKANIEINRKMLAQLAV
BAC10039|Bsu2881     MPRVKGGTVTRKRRKKVLKLAKGYFGSKHTLYKVANQQVMKSGNYAFRDRRQKKRDFRKLWITRINAAARMNGLSYSRLMHGLKLSGIEVNRKMLADLAV
ECO10039|rplT        MARVKRGVIARARHKKILKQAKGYYGARSRVYRVAFQAVIKAGQYAYRDRRQRKRQFRQLWIARINAAARQNGISYSKFINGLKKASVEIDRKILADIAV


THE10038|TTHA0553    REPQVFAELVERAKAAQG-
SYN10040|sll0767     LDPAAFSEVVKVAATAK--
BAC10039|Bsu2881     NDLTAFNQLADAAKAQLNK
ECO10039|rplT        FDKVAFTALVEKAKAALA-