CLUSTAL W (2.1) Multiple Sequence Alignments
HUM10054|RPL21       -MTNTKGKRRGTRYMFSRPFRKHGVVPLATYMRIYKKGDIVDIKGMGTVQKGMPHKCYHGKTGRVYNVTQHAVGIVVNKQVKGKILAKRINVRIEHIKHS
DOG10053|Rpl21       -MTNTKGKRRGTRYMFSRPFRKHGVVPLATYMRIYKKGDIVDIKGMGTVQKGMPHKCYHGKTGRVYNVTQHAVGIVVNKQVKGKILAKRINVRIEHIKHS
MUS10053|Rpl21       -MTNTKGKRRGTRYMFSRPFRKHGVVPLATYMRIYKKGDIVDIKGMGTVQKGMPHKCYHGKTGRVYNVTQHAVGIIVNKQVKGKILAKRINVRIEHIKHS
RAT10053|Rpl21       -MTNTKGKRRGTRYMFSRPFRKHGVVPLATYMRIYKKGDIVDIKGMGTVQKGMPHKCYHGKTGRVYNVTQHAVGIIVNKQVKGKILAKRINVRIEHIKHS
CHK10055|Rpl21       -MTNTKGKRRGTRYMFSRPFRKHGVVPLATYMRIYKKGDIVDIKGMGTVQQGMPHKCYHGKTGRVYNVTQHAVGVIVNKKVKGKILAKRINVRIEHIKHS
FUG10054|RPL21       -MTNTKGKRRGTRYMFSRPFRKHGPVPLSTYMRIYKKGDIVDIKGTGTVQKGMPHKCYHGKTGRVYNVTQHAVGIIVNKQVKGKILAKRINVRIEHVKHS
DAN10053|Rpl21       -MTNTRGKRRGTRYMFARPFRKHGPIPLSTYMRIYKKGDIVDIKGTGTIQKGMPHKCYHGKTGRVYNVTQHAVGIIVNKQVKGKILAKRINVRIEHIKHS
MED10053|Rpl21       -MTNTRGKRRGTRYMFSRPFRKHGPVPLSTYMRIYKKGDIVDIKGTGTIQKGMPHKCYHGKTGRVYNVTQHAVGIIVNKQVKGKILAKRINVRIEHVKHS
CIO10053|RPL21       -MTNTKGYRRGTRYMFSKKFRTRGVIGLTKYLTVYKKGDIVDIKGDGAVQKGMPHKVYHGKTGRVFNVTKHAVGVIVNKQVKGRILAKRINVRVEHVKHS
DRO10074|RpL21       -MTNSKGYRRGTRDMFSRPFRKHGVIPLSTYMRVFKIGDIVDIKGHGAVQKGLPYKAYHGKTGRIFNVTQHAVGVIVNKRVRGKILAKRVNVRIEHIHHS
MOS10054|Rpl21       -MTNSKGYRRGTRDMFSRGFRKHGTIPLSTYMKIYKSGDYVDIKGHGAVHKGMPYKAYHGKTGRVYNVSKHALGVIVNKRVRGKILPKRINVRVEHVQPS
BEE10055|Rpl21       -MTNSKGYRRGTRDLFSRKFRKHGTIPLSTYMKVYKVGDIVDIKGNGAVQKGMPYKVYHGKTGRVFNVTPHALGVIVNKRVRGRIIAKRINVRIEHLTHS
CEL10056|rpl-21      -MTNSKGLRRGTRYMFARDFRKHGVEHLSTYYTQYKRGDLVDIKTNGAFQKGMPFKAYHGRTGRIFNVTRGAVGIIVNKRVRGNILPKRINIRIEHIKPS
BMA10053|RPL21       -MVNPKGIRRGTRYMFAREFRKHGIEPLSTFYRTYKRGDIVDIKGNGAFQKGMPFKAYHGRTGRVFNVTKHAVGVLVNKRVRNRILQKRINVRIEHVRPS
STE10053|RPL21       -MTNTKGYRRGTRYMFSKKFRHRGVEHLSTYLKCYKVGDIVDVKANGAVQKGMPHKVYHGKTGRVYNVTKRALGVVVNKQVKGKILAKRINVRVEHVKHS
MBR10053|RPL21       -MGNTKGLRRGTRYMFSRDFRKRGPLNLETYLTVYKVGDIVDIKGNGAQQLGMPYKAYHGKTGRVYNVTKRALGVVVNKRIKNRYVAKKINVRIEHVKHS
NEU10054|Rpl21       -MGHAAGLRAGTRYAFSRNFREKGMIRLSTYLKQYKVGDIVDIKVNGAVQKGMAHKVYHGKTGVIYNVTKSAVGIIIYKKVKHRYIEKRINVRIEHIQPS
GRI10053|Rpl21       -MGHPAGLRAGTRYAFSRAHRQKGMIRLSTYLRQYRVGDIVDIKANGAVQKGMPHKVYHGKTGVVYNVTKSAVGVIIYKKVKHRYIEKRINLRIEHVVHS
GRA10054|Rpl21       -MGHSYGKRAGTRYAFSRDFRKKGMIALNTYLRQYRVGDIVDIKANGAVQKGMPFKVYHGKTGVIYNVTKSAVGVIIYKQVKHRYIEKRINVRIEHISQS
STA10053|Rpl21       -MGHAAGLRAGTRYAFSRDFKKKGMIPLSTYLKQYKVGDIVDVVANGAVQKGMPYKVYHGKTGIVYNVTKSAVGVILQKQVGNRYMEKRINVRIEHVRMS
YAR10054|Rpl21       -MGKSHGYRSRTRYMFSRDFKKNGTIPMSVYLKTYKVGDIVDIRANGSIQKGMPHKFYHGRTGIVYNVTKSAVGVIINKVVGNRFMEKRINLRIEHIKHS
POM10095|RPL21-1     -MPHSYGIRARTRYTFQRGFREHGQIRLSTYLKTYKVGDIVDIKVNGAVQKGMPHKYYHGKTGVVYNVTQSSVGVLIYKVVGNRYMEKRVNVRIEHVKHS
POM10096|RPL21-2     -MPHSYGIRARTRYTFQRGFREHGQIRLSTYLKTYKVGDIVDIKVNGAVQKGMPHKYYHGKTGVVYNVTQSSVGVLIYKVVGNRYMEKRVNVRIEHVKHS
YST10095|RPL21A      -MGKSHGYRSRTRYMFQRDFRKHGAVHLSTYLKVYKVGDIVDIKANGSIQKGMPHKFYQGKTGVVYNVTKSSVGVIINKMVGNRYLEKRLNLRVEHIKHS
YST10096|RPL21B      -MGKSHGYRSRTRYMFQRDFRKHGAVHMSTYLKIYKVGDIVDIKANGSIQKGMPHKFYQGKTGVVYNVTKSSVGVIINKMVGNRYLEKRLNLRVEHIKHS
CIN10054|Rpl21       -MPHSFGYRARTRHMFKRGFRENGPAKLTTFLTTYRVGDIVDIKANSAQQKGMPHKFYHGRTGIVYNVTPSAVGIIVYKVVGNRYVEKRVNIRIEHVKHS
NEA10053|Rpl21       -MPHSFGMRARTRHMFRRGFKEHGAPNVSTFLITYRVGDIVDIKANSSQQKGMPHKFYHGKTGIVYNVTPRAVGVIIYKVVNGRYMEKRVNIRVEHIRHS
MAY10053|Rpl21       -MTRRQQLRARTRHLFARKFRQHGPIKLSTYLRPFHAGDIVDIKANAAEQKGMPHKYYHGRTGVVFNVAPRAVGVIIYKVVGNRYIEKRVNVRIEHVKHS
RHI10208|Rpl21       -MPHSFGLRARTRHMFSRNFREHGVIPLSTYLKTYKVGDIVDIKANAAVQKGMPHKFYHGRTGIIYNVTKSSVGVIVHKVVGNRYIEKRVNVRVEHIRHS
RHI10209|Rpl21-2     -MPHSFGLRARTRHMFSRNFREHGVIPLSTYLKTYKVGDIVDIKANAAVQKGMPHKFYHGRTGIIYNVTKSSVGVIVHKVVGNRYIEKRVNVRVEHIRHS
RHI10210|Rpl21-3     -MPHSFGLRARTRHMFSRNFREHGVIPLSTYLKTYKVGDIVDIKANAAVQKGMPHKFYHGRTGIIYNVTKSSVGVIVHKVVGNRYIEKRVNVRVEHIRHS
ARA10149|RPL21A      -MPAGHGVRARTRDLFARPFRKKGYIPLSTYLRTFKVGDYVDVKVNGAIHKGMPHKFYHGRTGRIWNVTKRAVGVEVNKQIGNRIIRKRIHVRVEHVQQS
ARA10150|RPL21C      -MPAGHGVRARTRDLFARPFRKKGYIPLSTYLRTFKVGDYVDVKVNGAIHKGMPHKFYHGRTGRIWNVTKRAVGVEVNKQIGNRIIRKRIHVRVEHVQQS
ARA10151|RPL21E      -MPAGHGVRARTRDLFARPFRKKGYIPLSTYLRTFKVGDYVDVKVNGAIHKGMPHKFYHGRTGRIWNVTKRAVGVEVNKQIGNRIIRKRIHVRVEHVQQS
RIC10174|RPL21E      -MPAGHGLRARTRDLFARPFRKKGYIPLTTYLRTYKIGDYVDVKVNGAVHKGMPHKFYHGRTGRVWNVTKRAIGVEINKQVGNRIIRKRIHVRVEHVQPS
RIC10175|RPL21A      -MPAGHGLRARTRDLFARPFRKKGYIPLTTYLRTYKIGEHVDVKVNGAVHKGMPHKFYHGRTGRVWNVTKRAIGVEINKQVGNRIIRKRIHVRVEHVQPS
GMA10275|LOC10030562 -MPAGHGLRSRTRDSFSRPFRKKGTIALTTYLRTYHVGDYVDVKVNGAVHKGMPHKFYHGRTGRVWNVTKRAVGVEVNKQVGNRIIRKRIHVRVEHVMPS
GMA10276|LOC10050004 -MPAGHGLRSRTRDSFSRPFRKKGTIALTTYLRTYHVGDYVDVKVNGAVHKGMPHKFYHGRTGRVWNVTKRAVGVEVNKQVGNRIIRKRIHVRVEHVMPS
POP10054|RPL21       -MPAGHGLRSRTRDLFARPFRKKGYIPLTTYLRTYKVGDYVDIKVNGAVHKGMPHKFYHGRTGRVWNVTKRAIGVVINKQVGNRIIGKRIHVRVEHVQPS
CRE10053|RPL21       -MPGGQGLRARTRHMFARGFRQKGFIPLTTYLRTYKLGDMVDIKVNGAIHKGMPHKWYQGKTGTVWNVTKRAIGVEVNKRVGHRIMKKRIHVRVEHIVPS
VOL10056|RPL21       -MPGGQGLRARTRHMFARGFRQKGFIPLTTYLRTYKLGDFVDIKVNGAIHKGMPHKWYQGKTGVVWNVTKRAIGVEINKRVGHRIIKKRIHVRVEHVQPS
HEM10050|rpl21       -MSRSGGKRSNTRYTFSQAFRNHGPQHTSTYLKNFKIGELVDIKVNSFVHKGMPFKYYHGKTGKIFNITRSSVGLKIFKVVGNRKILKKINVKIEHIKKS
PTR10055|RPL21       -MPHSFGLRARTRHMFAKKHRQHGPIHLSQYLMKVKVGDYVDIFADPAVHKGMPHKGYHGRTGIIFNVTKSAVGVRVNKFVNGRIIEKRIHVRIEHVRKS
TPS10053|Rpl21       -MPHSFGVRARTRHMFAKKFRDHGPLHLSQYFLSVKVGDYVDIFANPSIHKGMPHKHYHGRTGIVFNVTKSSVGVRVNKLVNGRILEKRIHVRIEHIRKS
CYA10054|RPL21       -MVRSHGLRSNTRDKFAKPFRGHGKPLPSKYLTTYKVGEYVDIAADSSIHKGMPHKFYHGRTGRVFDVTPRSIGVEVNKEVNGRILVKRIHVRVEHVRPS
DIC10053|RPL21       -MPHSFGLRARTRYLFSRGFRNHGLLQTTTFLRTFRLGDYVDIKATGNVHKGMPHKFYHGRTGRVWNVTPRAVGVIINKRVGPRIIAKKIHVRTEHVKPS
PLA10060|RPL21       MGGKSRGKRSGTRYKFSKKFRKHGECTANKYLEKLNYGDYVDIVCDSTQQKGMPFNYYHGKTGKIFHITKRGVGVLVNKRVKHRIEQKKVCVRIEHVRKS
TGO10053|RPL21       -MPTSFGKRARTRQKFSKGFRRHGMPAVSRLLVIHKKGDYVDIVCDPSVQKGMPYSYYHGRTGIVFNVTQRAVGVEVNKVVGNRVIKKRIHVRLEHVRKS
GIA10053|Rpl21       -MTHSQGYRCKTRYCFARKFRRHGMANLTTYNRVYKLGQYVNIKVNGAYHKGMPHRYYNGRTGTIFNIGPRALGVQIQKRVRGRIMLKRINVRLEHVHPS
HAL10049|VNG1170G    -MPNSNGPLSNSGGKLQNDPRDRGTSPPQRAIADYDDGESVHLTLDPSVQDGRFHPRFSGLTGTVVGTQGDAFKVEVNDGG----MDKTLIVGAAHLRTQ
MET10045|MJ0040      MVQMSEGFRRKTRKKLSKHPRERGLYPITRALREFKEGEYVHIVIDPSVHKGMPHPRFHGRTGIVVGKQGRAFIVKVRDGG----KYKQIIAYPQHLRPA


HUM10054|RPL21       KSRDSFLKRVKENDQKKKEAKEKG---TWVQLKRQPAPPRE-AHFVRTNGKEPELLEPIPYEFMA------
DOG10053|Rpl21       KSRDSFLKRVKENDQKKKEAKEKG---TWVQLKRQPAPPRE-AHFVRTNGKEPELLEPIPYEFMA------
MUS10053|Rpl21       KSRDSFLKRVKENDQKKKEAKEKG---TWVQLKRQPAPPRE-AHFVRTNGKEPELLEPIPYEFMA------
RAT10053|Rpl21       KSRDSFLKRVKENDQKKKEAKEKG---TWVQLKRQPAPPRE-AHFVRTNGKEPELLEPIPYEFMA------
CHK10055|Rpl21       KSRDSFLQRVKENEKKKKEAKEKG---IWVQLKRQPAPPRE-AHFVRTNGKDPELLEPIPYEFMA------
FUG10054|RPL21       KSRDSFLQRVKENDAKKLEAKQNG---TWVELKRQPAPPRD-AHFVSTKKNAPQLLEPIPYEFMA------
DAN10053|Rpl21       KSRDSFLQRVKENEKKKVEAKKEG---TWIELKRQPAAPRP-AHFVSTKNNKPQLLEPIPYEFMA------
MED10053|Rpl21       KSRDSFLQRVKANEAKKLEAKQKG---TWVELKRQPAPPSE-AHFVSTKKNEPQLLEPIPYEFMA------
CIO10053|RPL21       KSRISFLKRVHENERKRAVAKQTG---VPCNLKRQPKQPRL-GHFVRSNGVEPELVEPVPWRFIA------
DRO10074|RpL21       KCREDFLRRVKENERLLKEAKEK---GQWVSLKRQPEQPKK-AHFVKKLE-EPIALAPIPYEFIA------
MOS10054|Rpl21       RCREDFLRRVKENVEKRMALRGKKLPGFKVSLKRKPKQPRQ-AQVIKNPP-KPIFLAPIPYEFVA------
BEE10055|Rpl21       KCREDFLKRVKENERLRKEAKEK---NIKVQLKRQPAEPMP-AHIVSGRE-NPISLAPIPYEFIA------
CEL10056|rpl-21      KCRTDFLNRVKSNDEKRKAAKSAG--QPVPALKRLPVAPRG-AHTVTTQNNEPELLAPLRFEIVA------
BMA10053|RPL21       KCRQDFLNRVKENEEKKRIARETG--QMVPIRR-MPKEPRK-AHLVKTRSNKPQLLVPVKFEIIA------
STE10053|RPL21       TCRDDFLRRVKENERKKHEAKAKG---LIAHCKRQPAQPKT-AHFVRTKRNKPVTLQPIPYEFVI------
MBR10053|RPL21       NSRKEFLRRAAENDAKKAEASARGE--RGVDVKRQPAGPKP-AEFVNFQTNEPVRLRPVPFEFMA------
NEU10054|Rpl21       RSRDDFLRRVKQNAELKKQAKAEG---KPVQLKRQALLPREARTISVVD-NKPETVAPVAYETTI------
GRI10053|Rpl21       RSREGFLRRVKENAEAKRKAKAEG---TTIQLKRQALQPREERTVSTKD-NKPISLAPVAYETTI------
GRA10054|Rpl21       RSREDFLKRVKANAEAKREAKATG---TVVQVKRQPLGPRGAHTLSLSE-NPPMTVTPLAYETTI------
STA10053|Rpl21       RSREDFLKRVKANFALQQKAKETG---EKQQLKRIPKQPQGERTVSLKD-NKPENITPVPYETTI------
YAR10054|Rpl21       KCRQEFLDRVKANDLKRKEAKAKN---EIVQLRRQPGATREAKTLAIDETNYPLTVAPLAYETFI------
POM10095|RPL21-1     KCRQDFLDRVKANEAKRKEAKAQG---KTVQLRRQPAPPAKAHFVSTEN-NEPVTLHPVAYDTTI------
POM10096|RPL21-2     KCRQDFLDRVKANEAKRKEAKAQG---KTVQLRRQPAPPATAHFVSTEN-NEPVTLHPVAYDTTI------
YST10095|RPL21A      KCRQEFLERVKANAAKRAEAKAQG---VAVQLKRQPAQPRESRIVSTEG-NVPQTLAPVPYETFI------
YST10096|RPL21B      KCRQEFLERVKANAAKRAEAKAQG---VAVQLKRQPAQPRESRIVSTEG-NVPQTLAPVPYETFI------
CIN10054|Rpl21       KCRQEFLERVKANHDAHVAAREKG---ERINLKRSPALPREAHVISLKD-NAPQTMTPVPYETTI------
NEA10053|Rpl21       KCRQEFLDRVKSNAAKKREAKEKG---EQVLLKRLPAQPREARVVSIHN-NVPQTLTARPYETFI------
MAY10053|Rpl21       KCRDDFLQRVKRNAELKKEAKAKG---EHVQLKRLPAAPRTAHTISMKN-NTPETLAPQAYDTYI------
RHI10208|Rpl21       KCRQEFLDRVKSNAQKKKEAKAAG---VTFNLKRLPAQPRDARHVSTKN-NVPQTIAPIPYETLI------
RHI10209|Rpl21-2     KCRQEFLDRVKSNAQKKKEAKAAG---VTFNLKRLPAQPRDARHVSTKN-NVPQTIAPIPYETLI------
RHI10210|Rpl21-3     KCRQEFLDRVKSNAQKKKEAKAAG---VTFNLKRLPAQPRDARHVSTKN-NVPQTIAPIPYETLI------
ARA10149|RPL21A      RCAEEFKLRKKKNDELKAAAKANGE---TISTKRQPKGPKP---GFMVEGMTLETVTPIPYDVVNDLKGGY
ARA10150|RPL21C      RCAEEFKLRKKKNDELKAAAKANGE---TISTKRQPKGPKP---GFMVEGMTLETVTPIPYDVVNDLKGGY
ARA10151|RPL21E      RCAEEFKLRKKQNDVLKADAKARGE---TISTKRQPKGPKP---GFMVEGMTLETVTPIPYDVVNDLKGGY
RIC10174|RPL21E      RCTEELRLRKIKNDQLKADAKARGE---VISTKRQPEGPKP---GFMVEGATLETVTPIPYDVVNDLKGGY
RIC10175|RPL21A      RCTEEFRLRKIKNDQLKADAKARGE---VISTKRQPQGPKP---GFMVEGATLETVTPIPYDVVNDLKGGY
GMA10275|LOC10030562 RCTEEFRLRKIKNDQLKAEAKAKGE---KISTKRQPQGPKP---GFMVEGATLETVTPIPYDVVNDLKGGY
GMA10276|LOC10050004 RCTEEFRLRKIKNDQLKAEAKVKGE---KISTKRQPQGPKP---GFMVEGATLETVTPIPYDVVNDLKGGY
POP10054|RPL21       RCREEFKLRKKKNDELKAEAKARGE---KISTKRQPQGPKP---GFMVEGATLETFTPIPYDVVNDLKGGY
CRE10053|RPL21       RCREEFLTRRASNDAAKAAAKAKGEP--VPKTKRVPAGPRD---GFELIPAKVETIAAIPYDIIKEGLV--
VOL10056|RPL21       RCREEFLARRAANDAAKAAAKAKGEP--VPKTKRVPQGPRG---GFELIPEKVETIAAIPYDIIKEGLV--
HEM10050|rpl21       NSKTEFLERIKAKDCIRRSKKNKG-----EKIFNFPKKNLVFNQRHIVSFRKIKSFEPEPYCVIV------
PTR10055|RPL21       KCQQEILRRKKENEAAKDEARKTG---NQVNLKRTPKLPKDGYMLAAPGGEGAEITTIQPLPFSDLV----
TPS10053|Rpl21       KCQKEIIARVKSNELAKAEARKTG---VKVDLKRHPKQPKEGYFLAAPGGD-GEITTIQPLPFSDLV----
CYA10054|RPL21       RCQEAFKALVRARDAARRAARAAGE-PKVIHEKRQPAGPRP-ARVVQVGAGGIKHLEAKPYEFIC------
DIC10053|RPL21       NSMAAHLKRIQENKKAVVEAKKAGK---WVDVRRNPAAPKD---GFFVNPRNTEFVEVKPVKYELLL----
PLA10060|RPL21       RCNEDFLLRKIKNAELIKEAKLKNE---HINIKRKTEGPKP-AAMIKVPPSKIITIEPLPFYEEY------
TGO10053|RPL21       RCNELFLRRVKENDAAHHEAHLKGE---SIKTKRQIPGPKP-GCFVSG---TMEVLEPAPFVESY------
GIA10053|Rpl21       DCRKNHLERVAANDAARRLAKETG-----QPVPCLKRQNALPRAAHVVSIASAIDITPLKYDGVF------
HAL10049|VNG1170G    RQEE-------------------------------------------------------------------
MET10045|MJ0040      TA---------------------------------------------------------------------