CLUSTAL W (2.1) Multiple Sequence Alignments
HUM10055|RPL22       ----------------------------------------------------------------------------------------------------
DOG10054|Rpl22       ----------------------------------------------------------------------------------------------------
MUS10054|Rpl22       ----------------------------------------------------------------------------------------------------
RAT10054|Rpl22       ----------------------------------------------------------------------------------------------------
FUG10055|RPL22       ----------------------------------------------------------------------------------------------------
DAN10054|Rpl22       ----------------------------------------------------------------------------------------------------
MED10054|Rpl22       ----------------------------------------------------------------------------------------------------
CIO10054|RPL22       ----------------------------------------------------------------------------------------------------
DRO10075|RpL22       MAPTAKTNKGDTKTAAAKPAEKKAAPAAAAAKGKVEKPKAEAAKPAAAAAKNVKKASEAAKDVKAAAAAAKPAAAKPAAAKPAAASKDAGKKAPAAAAPK
MOS10055|Rpl22       ----------------------------------------------------------------------------------------------------
BEE10056|Rpl22       ----------------------------------------------------------------------------------------------------
CEL10089|rpl-22      ----------------------------------------------------------------------------------------------------
BMA10054|RPL22       ----------------------------------------------------------------------------------------------------
STE10054|RPL22       ----------------------------------------------------------------------------------------------------
MBR10054|RPL22       ----------------------------------------------------------------------------------------------------
NEU10055|Rpl22       ----------------------------------------------------------------------------------------------------
GRI10054|Rpl22       ----------------------------------------------------------------------------------------------------
GRA10055|Rpl22       ----------------------------------------------------------------------------------------------------
STA10054|Rpl22       ----------------------------------------------------------------------------------------------------
YAR10055|Rpl22       ----------------------------------------------------------------------------------------------------
POM10097|RPL22       ----------------------------------------------------------------------------------------------------
YST10097|RPL22A      ----------------------------------------------------------------------------------------------------
YST10098|RPL22B      ----------------------------------------------------------------------------------------------------
CIN10055|Rpl22       ----------------------------------------------------------------------------------------------------
NEA10054|Rpl22       ----------------------------------------------------------------------------------------------------
MAY10054|Rpl22       ----------------------------------------------------------------------------------------------------
RHI10211|Rpl22       ----------------------------------------------------------------------------------------------------
ARA10152|RPL22A      ----------------------------------------------------------------------------------------------------
ARA10153|RPL22B      ----------------------------------------------------------------------------------------------------
ARA10154|RPL22C      ----------------------------------------------------------------------------------------------------
RIC10176|RPL22B      ----------------------------------------------------------------------------------------------------
RIC10177|RPL22C      ----------------------------------------------------------------------------------------------------
GMA10278|LOC10030555 ----------------------------------------------------------------------------------------------------
GMA10279|LOC10050007 ----------------------------------------------------------------------------------------------------
GMA10281|LOC10079007 ----------------------------------------------------------------------------------------------------
GMA10282|LOC10049971 ----------------------------------------------------------------------------------------------------
GMA10283|LOC10030554 ----------------------------------------------------------------------------------------------------
POP10055|RPL22       ----------------------------------------------------------------------------------------------------
CRE10054|RPL22       ----------------------------------------------------------------------------------------------------
VOL10057|RPL22       ----------------------------------------------------------------------------------------------------
PTR10056|RPL22       ----------------------------------------------------------------------------------------------------
TPS10054|Rpl22       ----------------------------------------------------------------------------------------------------
CYA10055|RPL22       ----------------------------------------------------------------------------------------------------
DIC10054|RPL22       ----------------------------------------------------------------------------------------------------
PLA10061|RPL22       ----------------------------------------------------------------------------------------------------
TGO10054|RPL22       ----------------------------------------------------------------------------------------------------
GIA10054|Rpl22       ----------------------------------------------------------------------------------------------------


HUM10055|RPL22       -------------------------------------------------------------------------MAPVKKLVVKGGKKKKQVLKFTLDCTH
DOG10054|Rpl22       -------------------------------------------------------------------------MAPVKKLVAKGGKKKKQVLKFTLDCTH
MUS10054|Rpl22       -------------------------------------------------------------------------MAPVKKLVAKGGKKKKQVLKFTLDCTH
RAT10054|Rpl22       -------------------------------------------------------------------------MAPVKKLVAKGGKKKKQVLKFTLDCTH
FUG10055|RPL22       ----------------------------------------------------------------------MAPIQKKQVVRKQGGKKKKQILKFTLDCTH
DAN10054|Rpl22       -------------------------------------------------------------------------MAPIKKQVTKGGKKKKQVLKFTLDCTH
MED10054|Rpl22       ----------------------------------------------------------------------------KKQNTGKGGKKKKQVLKFTLDCTH
CIO10054|RPL22       ---------------------------------------------------------------------MTAAVKKAPVVKGKGKKKKAPAKKFTLDCTH
DRO10075|RpL22       KDAKAAAAPAPAKAAPAKKAASTPAAAPPAKKAAPAKAAAPAAAAPAPAAAAPAVAKPAPKPKAKAAPAPSKVVKKNVLRGKG-QKKKKVSLRFTIDCTN
MOS10055|Rpl22       -----------------------------------------------------MSPVEKSVNAVKTKPAAQKPAQKNVLRGKNPIKKKREHLRYGIDCTN
BEE10056|Rpl22       ------------------------------------------------------------MAPPTTKKSKGPAIKKQALRGKG--QKKKVSLKFTIDCTH
CEL10089|rpl-22      -----------------------------------------------------------------------MVPKPHAKSAKKALRKKKVHLKFNVECKN
BMA10054|RPL22       ------------------------------------------------------------MVVASKVKKHIVLKRSKKSDSGKTKKKKKQTLKYNIECKN
STE10054|RPL22       -------------------------------------------------------------------------------MAKKSKKQQKKQLKFTVDCTH
MBR10054|RPL22       -------------------------------------------------------------------------------MPATKKSVKNQKKQFTIDCEV
NEU10055|Rpl22       --------------------------------------------------------------------------MAPITKKSAKGKGPKVTKKFVINASQ
GRI10054|Rpl22       ---------------------------------------------------------------------------MAPPQTKKTGKSSKTTKKFVINASQ
GRA10055|Rpl22       ------------------------------------------------------------------------MAPQAKKS----GKAQKQTKKYIIDASQ
STA10054|Rpl22       ------------------------------------------------------------------------MAPATKKSGAAAKKGQKVTKKFIINCSQ
YAR10055|Rpl22       -------------------------------------------------------------------------------MAP---VKTQKANKYTVDCKA
POM10097|RPL22       ----------------------------------------------------------------------------------MVKKNTKVSNKYIIDATA
YST10097|RPL22A      -------------------------------------------------------------------------------MAPNTSRKQKIAKTFTVDVSS
YST10098|RPL22B      -------------------------------------------------------------------------------MAPNTSRKQKVIKTLTVDVSS
CIN10055|Rpl22       --------------------------------------------------------------------------MPKAP---ANKAAAASKHKFVVDYSK
NEA10054|Rpl22       --------------------------------------------------------------------------MPKAPSTTKNAAAGKPLHKFFVDCSV
MAY10054|Rpl22       --------------------------------------------------------------------------MAVQKTTKASAKQGKTAHKFFIDFSG
RHI10211|Rpl22       ------------------------------------------------------------------------------MAPVKTSPAVAKKSKFIIDCSG
ARA10152|RPL22A      --------------------------------------------------------------------------MARVGAKSSGAGAKKKGVSFVIDCSK
ARA10153|RPL22B      ----------------------------------------------------------------------------MSRGGAAVAKGKKKGVSFTIDCSK
ARA10154|RPL22C      ----------------------------------------------------------------------------MSRGNAAAAKGKKKGVSFTIDCSK
RIC10176|RPL22B      ----------------------------------------------------------------------MARGVAVAAKG-GAGGKKKGSVSFVIDCSK
RIC10177|RPL22C      ----------------------------------------------------------------------MARGVAAAAGGKGGAGKKKGSVTFVIDCAK
GMA10278|LOC10030555 ----------------------------------------------------------------------------MSRGGAAAAKGKKKGATFTIDCAK
GMA10279|LOC10050007 ---------------------------------------------------------------------------------MSGAKGKKKGASFVIDCAK
GMA10281|LOC10079007 ----------------------------------------------------------------------------MSRGSATAAKGKKKGATFTIDCAK
GMA10282|LOC10049971 ---------------------------------------------------------------------------MSRGGAVAAAKGKKKGATFTIDCAK
GMA10283|LOC10030554 ---------------------------------------------------------------------------------MSGAKGKKKGASFVIDCAK
POP10055|RPL22       ----------------------------------------------------------------------------MSKATASGAKGKKKGVTFTVDCTK
CRE10054|RPL22       -------------------------------------------------------------------------MAVGVKKPAAKGAAKKKALVFTIDCSK
VOL10057|RPL22       -------------------------------------------------------------------------MAVGVKKPAAKGAAKKKALVFTIDCAK
PTR10056|RPL22       --------------------------------------------------------------------------------MVKGK---KSIVKFVIDCTQ
TPS10054|Rpl22       --------------------------------------------------------------------------------MAKGKGAKKGTVKFVIDCTA
CYA10055|RPL22       ---------------------------------------------------------------------------MPTKVKKNVSAKKATTRRFVLDCSA
DIC10054|RPL22       -------------------------------------------------------------------------------MPSVQKTVVKKSHKFVIDCTA
PLA10061|RPL22       ----------------------------------------------------MVAKKDSTKVSKKLKKKVVKKTKIVKGLKKQKMNKSTKGIKYVLDCTK
TGO10054|RPL22       ---------------------------------------------------------------------MRAAGSGRGAGGKKGAAAKPVKVKFTVDCQK
GIA10054|Rpl22       ----------------------------------------------------------------------------MRPRIKKCVKKEQGNIRFAVDCS-


HUM10055|RPL22       PVEDGIMDAANFEQFLQERIKVNGKAGNLGGGVVTIERSKSKITVTS--EVPFSKRYLKYLTKKYLKKNNLRDWLRVVANSK--ESYELRYFQINQDEEE
DOG10054|Rpl22       PVEDGIMDAANFEQFLQERIKVNGKAGNLGGGVVTIERSKSKITVTS--EVPFSKRYLKYLTKKYLKKNNLRDWLRVVANSK--ESYELRYFQINQDEEE
MUS10054|Rpl22       PVEDGIMDAANFEQFLQERIKVNGKAGNLGGGVVTIERSKSKITVTS--EVPFSKRYLKYLTKKYLKKNNLRDWLRVVANSK--ESYELRYFQINQDEEE
RAT10054|Rpl22       PVEDGIMDAANFEQFLQERIKVNGKAGNLGGGVVTIERSKSKITVTS--EVPFSKRYLKYLTKKYLKKNNLRDWLRVVANSK--ESYELRYFQINQDEEE
FUG10055|RPL22       PVEDGIMDAANFEQFLQERIKVNGKAGNLGGGVVSIERSKSKITVNS--EVPFSKRYLKYLTKKYLKKNNLRDWLRVVANTK--ESYELRYFQINQDEEE
DAN10054|Rpl22       PVEDGIMDAANFEQFLQERIKVNGKAGNLGGGVVSIERSKSKITVTS--EVPFSKRYLKYLTKKYLKKNNLRDWLRVVANTK--ESYELRYFQINQDEEE
MED10054|Rpl22       PVEDGIMDAANFEQFLQERIKVNGKAGNLGGGVVSIERSKSKITVSS--EVPFSKRYLKYLTKKYLKKNNLRDWLRVVANTK--ESYELRYFQINQDEEE
CIO10054|RPL22       PVEDGIMDAANFEQFLKDRVKVNGKTNNLG-QQVVIETLKNKVVITC--EIPFSKRYLKYLTKKYLKKNNLRDWLRVVASSK--ENYELRYFQINNDEDE
DRO10075|RpL22       IAEDSIMDVADFEKYIKARLKVNGKVNNLG-NNVTFERSKLKLIVSS--DVHFSKAYLKYLTKKYLKKNSLRDWIRVVANEK--DSYELRYFRISSNDDE
MOS10055|Rpl22       IAEDNIMDVADFEKYLKERFKVNGKAGNLG-SNVSFERQKMKVYVNS--DVHFSKRYLKYLTRKYLKKNSLRDWIRVVSNDK--DLYELRYFRISSNDDD
BEE10056|Rpl22       PAEDNIMDVANFEKYLHERIKVAGKTNNFG-NSVTLERDKMKLSVNS--DIDFSKRYLKYLTKKYLKKNKLRDWLRVVSKDK--ETYELRYFQINSQEDD
CEL10089|rpl-22      PVEDGILRIEDLEAFLNEKIKVNGKTGHLAANNVKVEVAKSKVSVVS--EVPFSKRYLKYLTKKYLKRNSLRDWLRVVAVNK--NTYEVRYFHINDGEDA
BMA10054|RPL22       PVEDGIMNVNDFGTFLNERIKVNGKVGTMAANGVRLEVTKTKLILTS--EVPFSKRYLKYLTKKYLKRNSLRDWLRVVASSK--DTYELRYFRINQDDED
STE10054|RPL22       PVEDGIMDVANFEQFLHDRIKVQGKTNNLG-SEVTIERMKNKLNVVS--DIPFSKRYLKYLTKKYLKKNNLRDWLRVVAADH--TSYELRYFQISNEEED
MBR10054|RPL22       ATEEGIIDLAAFEKFLQDRIKVNGKTGGLQGVVDLTRTASAITVTTE---APFPKRYLKYLTKKFLKKMQLRDAFRVVAVNAS--TYKLSWFNISDEAEE
NEU10055|Rpl22       PASDKIFDVSAFEKFLTEKIKVEGRVGNLGDAIKISQVGDGKIEIVA--HNELSGRYLKYLTKKFLKKMQLRDWLRVVSTSR--GVYELKFFNVVNDEAE
GRI10054|Rpl22       PVNDKIFDISAFEKFLNEKIKIDGRVGQLGDTIVISQVPDGKIEIVA--HNELSGRYLKYLTKKFLKKQQLRDWLRVVSTSK--GVYELKFFNVVNDADD
GRA10055|Rpl22       PASDKIFDVAAFEKFLQDRIKVEGRTNNLGDNVVVKQQGEGKIEIIA--HNELSGRYLKYLTKKFLKKQQLRDWLRVVSTSR--GVYELKFFNVVNDEAD
STA10054|Rpl22       PVNDKIFDIQAFEKFLHDRIKVEGRTGNLGDTVAISQQGDGKIEVIA--HQEFSGRYLKYLTKKFLKKQQLRDWLRVVSTSK--GVYELRFFNVVNDEAE
YAR10055|Rpl22       PSADGIFDVSSFEKFLTERIKVEGRTNQLGEDIKVSSNGD-IVTVVS--TTQFSGKYLKYLTKKYLKKQQLRDWIRVISTSK--GNYTLKFYNVVANEED
POM10097|RPL22       AVNDKIFDVAAFEKYLIDRIKVDGKTGNLGSSVVVSREGSSKIAVIA--HIDFSGRYLKYLTKKFLKKHSLRDWLRVVSTKK--GVYELRYYNVVVGNDE
YST10097|RPL22A      PTENGVFDPASYAKYLIDHIKVEGAVGNLGNAVTVTEDGT-VVTVVS--TAKFSGKYLKYLTKKYLKKNQLRDWIRFVSTKT--NEYRLAFYQVTPEEDE
YST10098|RPL22B      PTENGVFDPASYSKYLIDHIKVDGAVGNLGNAIEVTEDGS-IVTVVS--SAKFSGKYLKYLTKKYLKKNQLRDWIRFVSIRQ--NQYKLVFYQVTPEDAD
CIN10055|Rpl22       PAADGVFDGADFEKFLHDRIKVEGKAGQLGDNVKIVRDGNTKITITA--NIPFSKRYIKYLTKKFLKKNSLRDWIRVVATSK--DNYSLKFYNIAAGDDE
NEA10054|Rpl22       PVNDSVFDLAAFEKFLHDRIKVDGKPGQLGDVVAVQKEG-AKIVLTS--QIPFSKRYLKYLTKKHLKKNSFENFLRVVATSK--DTYSLKYFKVDQDEAE
MAY10054|Rpl22       PANDGILDAAAFEKYLHDRIKVDGKAGNLGDHVQITREGEGKIWVNT--NVAFSKRYLKYLTKKHLRKQQLRDWLRVVATSK--QGYEIKFFNVSYDQEE
RHI10211|Rpl22       PANDKIFDAAAFEKYLHDRIKVDGRTNNLGEAIAISRSADNKITVVA--NIAFSKRYLKYLTKKFLKKNQIRDWLRVIATDK--QTFELRYFNIANDENE
ARA10152|RPL22A      PVDDTILEIATLEKFLQERIKVRG-KAGALGNSVSITRYNGKINVNA--NSNFSKRYLKYLTKKYLKKYNLRDWLRVIASNKDKNVYEVRYFRIDDEVAS
ARA10153|RPL22B      PVDDKIMEIASLEKFLQERIKVGG-KAGALGDSVTITREKSKITVTA--DGQFSKRYLKYLTKKYLKKHNVRDWLRVIAANKDRNLYELRYFNIAENEGE
ARA10154|RPL22C      PVDDKIMEIASLEKFLQERIKVGG-KAGALGDSVSITREKSKITVTA--DGQFSKRYLKYLTKKYLKKHNVRDWLRVIAANKDRNLYELRYFNIAENEAE
RIC10176|RPL22B      PVEDKIMEIASLEKFLQERIKVAGGKAGNLGDSVTVTRDKTKVTVTS--DGAFSKRYLKYLTKKYLKKHNVRDWLRVIAANKDRNVYELRYFNIAENEGE
RIC10177|RPL22C      PVDDKIMEIASLEKFLQERIKVAGGKAGNLGESVTVSRDKTKVTVTS--DGPFSKRYLKYLTKKYLKKHNVRDWLRVIASNKDRNVYELRYFNIAENEGE
GMA10278|LOC10030555 PVEDKIMDIASLEKFLQERIKVGG-KAGALGDSVTVTREKTKIILTS--DCNFSKRYLKYLTKKYLKKHNVRDWLRVIASNKDRSVYELRYFNIAENEGE
GMA10279|LOC10050007 PVEDKIMDIASLEKFLQERIKVGG-KAGALGDSITVTRDKSKITVTS--DSNFSKRYLKYLTKKYLKKHNVRDWLRVIASNKERNVYELRYFNIAENEGE
GMA10281|LOC10079007 PVEDKIMDIASLEKFLQERIKVGG-KAGALADTITVTREKTKIIVTS--DSNFSKRYLKYLTKKYLKKHNVRDWLRVIASNKDRSIYELRYFNIAENEGE
GMA10282|LOC10049971 PVEDKIMDIASLEKFLQERIKVGG-KAGALGDSITVTREKTKIIVTS--DSNFSKRYLKYLTKKYLKKHNVRDWLRVIASNKDRSVYELRYFNIAENEGE
GMA10283|LOC10030554 PVEDKIMDIASLEKFLQERIKVGG-KAGALGDSITVTRDKSKITVTS--DSNFSKRYLKYLTKKYLKKHNVRDWLRVIASNKERSVYELRYFNIAENEGE
POP10055|RPL22       PVEDKIMDIASLEKFLQERIKVGG-KAGALGDTVTVTREKSKITVTS--DSNFSKRYLKYLTKKYLKKHNVRDWLRVISSNKDRNVYELRYFNIAENEGE
CRE10054|RPL22       PVEDKIMDISSFEKFLMDKIKVDG-KTGVLGDSIKVAKEKTKVTVTA--ESQLSKRYLKYLTKKYLKKHNVRDWLRVIASNKDRNVYELRYFNIADNEAE
VOL10057|RPL22       PVEDKIMDISSFEKFLLDKIKVDG-KTGVLGDSIKVAKEKTKVTVTA--ETHLSKRYLKYLTKKYLKKHNVRDWLRVIASNKDRNVYELRYFNIADNDAE
PTR10056|RPL22       PVDDKVLDVAQFEKYLHDRLKIGGKTGQLATSGVVLSRDRTKLTVASPAELGFSKRQLKYLSKRYLKKQQLKNYMRVVAASK--NSYEMRYYAISGGDGD
TPS10054|Rpl22       PVDDKVLDVASFEKYLQERIKVEGKTGNLAQNNVTVSRDRTKLTIASPSDLGFSKRQLKYLSKRYLKKQQLRDYLRVVAASK--NSYELRYYSISAGDDE
CYA10055|RPL22       PVGDAILDTASLEKFLQDRIKVNGKTGQLGDFVAVSRDGRTRIAVVT--RVPFSKRYLKYLAKKYLKKQQLRDFLRVVATGP--DTYELRYFSIHDEDVE
DIC10054|RPL22       PAG-KIVDVAAFEKYLHDRIKVDNKVGNLGSTVVISKDKS-KIIINT--TIPFSKRYLKYLTKKFLKFKQIRDFLRVVATTK--NTYELRYFNIGDSESQ
PLA10061|RPL22       PVKDTILDISGLEQFFKDKIKVDK-KTNNLKNKVVVTSDEYKIYITV--HIPFSKRYIKYLAKKYIKMHQIRDFLRVIAKGK--LAYEFKYFQLNN----
TGO10054|RPL22       PVDDNIIEAKGLERFLQTHIKVDG-KCNNLGDRVQVSREKAKVFVTA--ELPFSKRYIKYLTKKYLKKQMLRDFMRVVSSRD--TVYELRYFQMPQEDET
GIA10054|Rpl22       AGKDLELNLNEFADYVRTHFKINNRKHGVAEKVACSVEGDSLVIQTTG--YEFAKRYVKYLTKRFLY-QDYQGVFRVLSTDK--ETYTLKPYTIEDDDDE


HUM10055|RPL22       EEDED----------
DOG10054|Rpl22       EEDED----------
MUS10054|Rpl22       EEDED----------
RAT10054|Rpl22       EEDED----------
FUG10055|RPL22       EEED-----------
DAN10054|Rpl22       EDED-----------
MED10054|Rpl22       EEDED----------
CIO10054|RPL22       EEEED----------
DRO10075|RpL22       DDDAE----------
MOS10055|Rpl22       EEENE----------
BEE10056|Rpl22       DEEDAE---------
CEL10089|rpl-22      GSDHE----------
BMA10054|RPL22       IGDNKKDDEDADNNK
STE10054|RPL22       EEADEES--------
MBR10054|RPL22       EEADE----------
NEU10055|Rpl22       EDEE-----------
GRI10054|Rpl22       EDDE-----------
GRA10055|Rpl22       EDDE-----------
STA10054|Rpl22       DDDE-----------
YAR10055|Rpl22       EE-------------
POM10097|RPL22       EEQ------------
YST10097|RPL22A      EEDEE----------
YST10098|RPL22B      EEEDDE---------
CIN10055|Rpl22       EDDE-----------
NEA10054|Rpl22       EDELA----------
MAY10054|Rpl22       AEN------------
RHI10211|Rpl22       EEEE-----------
ARA10152|RPL22A      YEED-----------
ARA10153|RPL22B      EED------------
ARA10154|RPL22C      EED------------
RIC10176|RPL22B      EED------------
RIC10177|RPL22C      EED------------
GMA10278|LOC10030555 EED------------
GMA10279|LOC10050007 EED------------
GMA10281|LOC10079007 EED------------
GMA10282|LOC10049971 EED------------
GMA10283|LOC10030554 EED------------
POP10055|RPL22       EED------------
CRE10054|RPL22       DEE------------
VOL10057|RPL22       EDE------------
PTR10056|RPL22       DEE------------
TPS10054|Rpl22       DAEE-----------
CYA10055|RPL22       KDEEDMEEDE-----
DIC10054|RPL22       E--------------
PLA10061|RPL22       ---------------
TGO10054|RPL22       AA-------------
GIA10054|Rpl22       AGTDDE---------