CLUSTAL W (2.1) Multiple Sequence Alignments
HAL10028|VNG1695G    ----MGISYSVD-VDSEASAKAMLRERSISLKHSKAIAREISGETVADAKEYLQAVIDEERSVPFKQHNSGVGHRNDI---DGWDAGRYPEKASKDFLKL
MET10046|MJ0460      VIMMGKLKYKIQ-VNPEKTARAMGRNIPISRKHAREICKSINGMKLDEAIKFLEDVIAMRRPVLFRRHCKKVGHRKGK---LGWPAGRYPVKAAKAILKI
PYR10029|PH1773      --MGKRFGYSFQNFDPERMARASGRDLRISPKLAVEVCRELRGMMLNDALRYLDEVIALKRPVPLRRYNDSQGHKPG----KGFGPGRYPVKVAKAIKKV
THE10040|TTHA1687    -----------------MEAKAIARYVRISPRKVRLVVDLIRGKSLEEARNILRYTN---------------------------------KRGAYFVAKV
SYN10042|sll1803     ----------MTKLDTTAEVKAIARYVRMSPLKVRRVLDQIRGRSYREALIILEFMP---------------------------------YKACEPVLKV
BAC10041|Bsu0121     -----------------MQAKAVARTVRIAPRKARLVMDLIRGKQVGEAVSILNLTP---------------------------------RAASPIIEKV
ECO10041|rplV        -----------------METIAKHRHARSSAQKVRLVADLIRGKKVSQALDILTYTN---------------------------------KKAAVLVKKV
SUL10031|ST0425      ---MAGWTYPKLDIDENKLAKAVIKNVPASIRDLYNVCKAIRGMKLNDAKQFLNNVLEEKEALPFWKHSHGASHRSNISPKWKVKSGRYPKKAIKYVLKV


HAL10028|VNG1695G    LSNVSNNADQ-QGFDADEMVIEHVAPHKVGESQGRKPRAMGRATTWNATLCDVEIVVTETEEVTA
MET10046|MJ0460      LQHAKANAEY-KGLNTEKLRIKHISTNKGITIKRYMPRAFGRATPKFQETVHIQVILEEYH----
PYR10029|PH1773      LLNAKNNAEQ-KGLDPDKLKIIHIAAHRGPVLRGWYPRAFGRATPFNEQTTHIEVVVEEIRR---
THE10040|TTHA1687    LESAAANAVNNHDMLEDRLYVKAAYVDEGPALKRVLPRARGRADIIKKRTSHITVILGEKHGK--
SYN10042|sll1803     LRSAVANAEHNEGLEPADLVVSQAFADGGPSLRRFRPRAQGRAYQIRKPTCHITVAVAPALADN-
BAC10041|Bsu0121     LKSAIANAEHNYEMDANNLVISQAFVDEGPTLKRFRPRAMGRASQINKRTSHITIVVSEKKEG--
ECO10041|rplV        LESAIANAEHNDGADIDDLKVTKIFVDEGPSMKRIMPRAKGRADRILKRTSHITVVVSDR-----
SUL10031|ST0425      LENAENNANS-KGLDLENVKIVHIAAHKGIILKRYMPRAFGRSTRKYRYTSHIEVILGEV-----