CLUSTAL W (2.1) Multiple Sequence Alignments
HUM10056|RPL23       -----MSKRGRGGSSGAKFRISLGLPVGAVINCADNTGAKNLYIISVKGIKGRLNRLPAAGVGDMVMATVKK-GKPELRKKVHPAVVIRQRKSYRRKDGV
DOG10055|Rpl23       -----MSKRGRGGSSGAKFRISLGLPVGAVINCADNTGAKNLYIISVKGIKGRLNRLPAAGVGDMVMATVKK-GKPELRKKVHPAVVIRQRKSYRRKDGV
MUS10055|Rpl23       -----MSKRGRGGSSGAKFRISLGLPVGAVINCADNTGAKNLYIISVKGIKGRLNRLPAAGVGDMVMATVKK-GKPELRKKVHPAVVIRQRKSYRRKDGV
RAT10055|Rpl23       -----MSKRGRGGSSGAKFRISLGLPVGAVINCADNTGAKNLYIISVKGIKGRLNRLPAAGVGDMVMATVKK-GKPELRKKVHPAVVIRQRKSYRRKDGV
CHK10057|Rpl23       -----MSKRGRGGSSGAKFRISLGLPVGAVIKGADNTGAKNLYIISVKGIKGRLNRLPAAGVGDMVMATVKK-GKPELRKKVHPAVVIRQRKSYRRKDGV
FUG10056|RPL23       -----MSKRGRGGSSGAKFRISLGLPVGAVINCADNTGAKNLYIISVKGIKGRLNRLPSAGVGDMVMATVKK-GKPELRKKVHPAVVIRQRKSYRRKDGV
DAN10055|Rpl23       -----MSKRGRGGSSGAKFRISLGLPVGAVINCADNTGAKNLYIISVKGIKGRLNRLPSAGVGDMVMATVKK-GKPELRKKVHPAVVIRQRKSYRRKDGV
MED10055|Rpl23       -----MSKRGRGGSSGAKFRISLGLPVGAVINCADNTGAKNLYIISVKGIKGRLNRLPAAGVGDMVMATVKK-GKPELRKKVHPAVVIRQRKSYRRKDGV
CIO10055|RPL23       -----MSKRGRGGAAGGKFRISLSLPVGAVVNCADNTGAKNLYIIAVKGIRGRLNRLPAAGVGDIVLATVKK-GKPELRKKVHPAVIIRQSKSYRRKHGQ
DRO10076|RpL23       -----MSKRGRGGTAGGKFRISLGLPVGAVMNCADNTGAKNLYVIAVHGIRGRLNRLPAAGVGDMFVATVKK-GKPELRKKVMPAVVIRQRKPFRRRDGV
MOS10056|Rpl23       -----MSKRGRGGSAGGKFRISLGLPVGAVINCADNTGAKNLYVIAVHGIRGRLNRLPAAGVGDMFVATVKK-GKPELRKKVMPAVVIRQRKPFRRRDGV
BEE10057|Rpl23       -----MSKRGRGGSAGAKFRISLGLPVGAVINCADNTGAKNLYVIAVQGIKGRLNRLPAAGSGDMIVATVKK-GKPELRKKVMPAVVIRQRKPFRRKDGV
CEL10058|rpl-23      -----MSKRGRGGASGAKFRISLGLPVGAVMNCADNTGAKNLFVISVYGIRGRLNRLPSAGVGDMFVCSVKK-GKPELRKKVLQGVVIRQRKQFRRKDGT
BMA10055|RPL23       -----MSKRGRGGASGAKFRISLGLPVGAVMNCADNTGAKNLFVIAVYGIKGRLNRLPSAGVGDMFVASVKK-GKPELRKKVLQAVVVRQRKQYRRKDGS
STE10055|RPL23       -----MSKRGRGGTSGGKFRIALGLPVGAVINCADNTGGKNLYIIAVKGIKGRLNRLPAAASGDMVLATVKK-GKPELRKKVMPAVVIRQRKAYRRKNGV
MBR10055|RPL23       -----MSKRGAGGGRVHKFRISLGLPVAAVMNCADNTGAKNLYVVAVNGWGARLNRMPAACIGDMFVATVKK-GKPELRKKVMPAVVIRQRKQFRRKDGG
NEU10056|Rpl23       ------MAKQSRGAPGGKLKMTLGLPVGAIMNCADNSGARNLYIISVKGIGARLNRLPAGGVGDMVMATVKK-GKPELRKKVHPAVIVRQSKPWKRFDGV
GRI10055|Rpl23       ------MAKLSRGAPGGKLKMTLGLPVGAIMNCADNSGARNLYIISVKGIGARLNRLPAGGVGDMVMATVKK-GKPELRKKVHPAVIVRQSKPWKRTDGV
GRA10056|Rpl23       ------MAKISRGAPGGKLKMTLGLPVGAVMNCADNSGARNLYIIAVKGIGARLNRLPAGGVGDMVMATVKK-GKPELRKKVHPAVIVRQSKPWKRFDGV
STA10055|Rpl23       ----MASKRGRGSSSGNKLKMTLGLPVGAVMNCCDNSGARNLYIISVKGIGARLNRLPAGGAGDMVMATVKK-GKPELRKKVMPAVIVRQSKPWRRADGV
YAR10056|Rpl23       ----------MSGASGTKYKMSMALPVGAIMNCADNSGARNLYVIAVKGCGARLNRLPAAGAGDMVMATVKK-GKPELRKKVMPAIVVRQSKPWRRKDGV
POM10098|RPL23-1     ------MSRGRGAASGTKYRMTLGLPVQAIMNCADNSGAKNLYIVSVFGTGARLNRLPAASCGDMVLATVKK-GKPDLRKKIMPAIVVRQRKAWRRKDGV
POM10099|RPL23-2     ------MSRGRGAASGTKYRMTLGLPVQAIMNCADNSGAKNLYIVSVFGTGARLNRLPAASCGDMVLATVKK-GKPDLRKKIMPAIVVRQRKAWRRKDGV
YST10099|RPL23A      --------MSGNGAQGTKFRISLGLPVGAIMNCADNSGARNLYIIAVKGSGSRLNRLPAASLGDMVMATVKK-GKPELRKKVMPAIVVRQAKSWRRRDGV
YST10100|RPL23B      --------MSGNGAQGTKFRISLGLPVGAIMNCADNSGARNLYIIAVKGSGSRLNRLPAASLGDMVMATVKK-GKPELRKKVMPAIVVRQAKSWRRRDGV
CIN10056|Rpl23       -------MSKPVKAQGTKYRLTMGLPTGAVINCADNSGAKSLYIIEPYGTGARLNRLPDAGVGDIVVASVKK-GKPELRKKTMPAIIVRQRKAWRRRDGV
NEA10055|Rpl23       -------MSIKSAAAGTKFRMSLGLPVGAVMNCADNSGAKNLYVISVIGFGARLNRLPAAAAGDMVMASVKK-GKPELRKKVMPAVICRQRKPWRRRDGI
MAY10055|Rpl23       ---------MSKAAVGTKFRMTLALPVGAVMNCADNSGAKNLFVIAVHGIGARLNRLPAAAAGDMVVASVKK-GKPELRKKVMPAVVVRQRKPWRRRDGV
RHI10212|Rpl23-2     --------MPKVSVSGTKYRMTLGLPVGAVMNCADNSGAKNLYVIAVRNIKGRLNRLPAAGCGDMVVATVKK-GKPELRKKVLAAVVVRQRKAWRRRDGV
RHI10213|Rpl23-3     --------MPKVSVSGTKYRMTLGLLVGAVMNCADNSGAKNLYVIAVRNIKGRLNRLPAAGCGDMVVATVKK-GKPELRKKVLAAVVVRQRKAWRRRDGV
RHI10214|Rpl23-4     --------MPKVSVSGTKYRMTLGLPVGAVMNCADNSGAKNLYVIAVRNIKGRLNRLPAAGCGDMVVATVKK-GKPELRKKVLAAVVVRQRKAWRRRDGV
RHI10218|Rpl23       --------MPKVSVSGTKYRMTLGLPVGAVMNCADNSGAKNLYVIAVRNIKGRLNRLPAAGCGDMVVATVKK-GKPELRKKVLAAVVVRQRKAWRRRDGV
ARA10155|RPL23A      -----MSKRGRGGTSGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDMVMATVKK-GKPDLRKKVLPAVIVRQRKPWRRKDGV
ARA10156|RPL23B      -----MSKRGRGGTSGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDMVMATVKK-GKPDLRKKVLPAVIVRQRKPWRRKDGV
ARA10157|RPL23C      -----MSKRGRGGTSGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDMVMATVKK-GKPDLRKKVLPAVIVRQRKPWRRKDGV
RIC10178|RPL23B      -----MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDMVMATVKK-GKPDLRKKVMPAVIVRQRKPWRRKDGV
RIC10179|RPL23A      -----MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDMVMATVKK-GKPDLRKKVMPAVIVRQRKPWRRKDGV
RIC10180|RPL23C      -----MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDMVMATVKK-GKPDLRKKVMPAVIVRQRKPWRRKDGV
GMA10284|LOC10078629 -----MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDMVMATVKK-GKPDLRKKVLPAVIVRQRKPWRRKDGV
GMA10285|LOC10081163 -----MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDMVMATVKK-GKPDLRKKVLPAVIVRQRKPWRRKDGV
GMA10286|LOC10079411 -----MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDMVMATVKK-GKPDLRKKVLPAVIVRQRKPWRRKDGV
GMA10287|LOC10030669 -----MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDMVMATVKK-GKPDLRKKVLPAVIVRQRKPWRRKDGV
POP10056|RPL23       -----MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDMVMATVKK-GKPDLRKKVMPAVIVRQRKPWRRKDGV
CRE10055|RPL23       -----MANKRKGGTSGNKFRMALGLPVAAVMNCADNTGAKNLYVISVVGWGSRLNKLPAAACGDMVMASVKK-GKPDLRKKVTPAVVIRQRKPFRRKEGV
VOL10058|RPL23       -----MASKRKGGTSGNKFRMALGLPVAAVMNCADNTGAKNLYVISVVGWGSRLNRLPAAACGDMVMASVKK-GKPDLRKKVTPAVVIRQRKPFRRKEGV
HEM10052|rpl23       -----MGKRGRGASVGNKFRTSLGLPVGAIINCADNTGAKNLYIIAVTRIKGRLNRLPASSIGDMVLATVKK-GKPELRKKVLTAIIIRQKKFWRRKDGV
PTR10057|RPL23       --MGEKGQRGRALASGIKHRVSAGLPVAAVVNCADNSGAKNLRIIAVCNIGGRLNRYPKASSGDMVMCAVKK-GKPELRKKVMPAVIVRQRKAFRRKEGV
TPS10055|Rpl23-1     MGEKNLGPRGRAAASGIKHRVAAGLPVAAVINCADNSGAKNLHIIAVCNIGGRLNRLPKAGSGDMVMASIKK-GKPELRKKVMPAIIVRQRKSFRRKEGV
TPS10056|Rpl23-2     MGEKNLGPRGRAAASGIKHRVAAGLPVAAVINCADNSGAKNLHIIAVCNIGGRLNRLPKAGSGDMVMASIKK-GKPELRKKVMPAIIVRQRKSFRRKEGV
CYA10056|RPL23       -----MSKRGRGGAAGTKFRCTLGLPVGAVINCADNSGAKNLYIIAVHGVRGRLNRLPAASIGDMVLVTVKK-GKPELRKKVMPAVVVRQRKAWRRKDGT
DIC10055|RPL23       --------MSKAQAVGSNYRVSLGLPVGAVMNSADNSGAKNLYVIAVKGIKGRLNRLPSAGVGDMVMATVKK-GKPELRKKVCTGLVVRQRKHWKRKDGV
PLA10062|RPL23       ------MKRGRAGTLKNKMRITLSLPVGALINCCDNSGGKNLYIIAVQGFGSCLNRLPAASLGDMVLATVKK-GKPDLRKKVLNAIICRQSKAWRRHEGY
TGO10055|RPL23       ------MKRGRGGVGGSKMRVTLGLPVGALINCCDNSGAKNLYIIAVKGWGSCLNRLPACSLGDLVLATVKK-GKPDLRKKVHMAIIVRQRRAWRRAEGY
GIA10055|Rpl23       ----MASKRGRSGGIGNKFRISCGLPVGAVINCADNSGAKSLNMIAVKNWKGHLNRFPKASVGDMVLITVGRDGKPELRRKVTPAVVVRQRKVWRRKDGV


HUM10056|RPL23       FLYFEDNAGVIVNNKGEMKG-SAITGPVAKECADLWPRIASNAGSIA
DOG10055|Rpl23       FLYFEDNAGVIVNNKGEMKG-SAITGPVAKECADLWPRIASNAGSIA
MUS10055|Rpl23       FLYFEDNAGVIVNNKGEMKG-SAITGPVAKECADLWPRIASNAGSIA
RAT10055|Rpl23       FLYFEDNAGVIVNNKGEMKG-SAITGPVAKECADLWPRIASNAGSIA
CHK10057|Rpl23       FLYFEDNAGVIVNNKGEMKG-SAITGPVAKECADLWPRIASNAGSIA
FUG10056|RPL23       FLYFEDNAGVIVNNKGEMKG-SAITGPVAKECADLWPRIASNAGSIA
DAN10055|Rpl23       FLYFEDNAGVIVNNKGEMKG-SAITGPVAKECADLWPRIASNAGSIA
MED10055|Rpl23       FLYFEDNAGVIVNNKGEMKG-SAITGPVAKECADLWPRIASNAGSIA
CIO10055|RPL23       MIYFEDNAGVIVNQKGEMKG-SAITGPVAKECADCWPRIASNASSIA
DRO10076|RpL23       FIYFEDNAGVIVNNKGEMKG-SAITGPVAKECADLWPRIASNASSIA
MOS10056|Rpl23       FLYFEDNAGVIVNNKGEMKG-SAITGPVAKECADLWPRIASNAGSIA
BEE10057|Rpl23       FIYFEDNAGVIVNNKGEMKG-SAITGPVAKECADLWPRIASNASSIA
CEL10058|rpl-23      FIYFEDNAGVIVNNKGEMKG-SAITGPVAKECADLWPRIAANAGSIA
BMA10055|RPL23       FIYFEDNAGVIVNNKGEMKG-SAITGPVAKECADLWPRIASNAGSIA
STE10055|RPL23       FLYFEDNAGVIVNVKGEMKG-SAITGPVAKECADLWPRIASNAGSIQ
MBR10055|RPL23       ILYFEDNAGVIVNVKGEMKG-SAINGPVAKEAADAWPRIASAAPSIA
NEU10056|Rpl23       FLYFEDNAGVIVNPKGEMKG-SAITGPVGKEAAELWPRIASNSGVVM
GRI10055|Rpl23       FLYFEDNAGVIVNPKGEMKG-SAITGPVGKEAAELWPRIASNSGVVM
GRA10056|Rpl23       FLYFEDNAGVIVNPKGEMKG-SAITGPVGKEAAELWPRIASNSGVVM
STA10055|Rpl23       FLYFEDNAGVIVNPKGEMKG-SAITGPVAKEAAELWPRIASNSGVVM
YAR10056|Rpl23       YLYFEDNAGVIVNPKGEMKG-SAITGPVAKECADLWPRIASNSGVVV
POM10098|RPL23-1     YLYFEDNAGVIVNPKGEMKG-SAITGPVAKECADLWPRIASNAGTVV
POM10099|RPL23-2     YLYFEDNAGVIVNPKGEMKG-SAITGPVAKECADLWPRIASNAGTVV
YST10099|RPL23A      FLYFEDNAGVIANPKGEMKG-SAITGPVGKECADLWPRVASNSGVVV
YST10100|RPL23B      FLYFEDNAGVIANPKGEMKG-SAITGPVGKECADLWPRVASNSGVVV
CIN10056|Rpl23       FLYFEDNAGVIVNPKGEMKG-SAITGPVAKECADLWPRIASNAGTVV
NEA10055|Rpl23       FLYFEDNAGVIVNAKGEMKG-SAINGPVAKECADLWPRIASNAGTVV
MAY10055|Rpl23       FLYFEDNAGVIVNPKGEMKG-SAITGPVAKECADIWPRIASNAGTVV
RHI10212|Rpl23-2     FLYFEDNAGVIVNPKGEMKG-SAITGPVAKECADLWPRIASASGTVV
RHI10213|Rpl23-3     FLYFEDNAGVIVNPKGEMKG-SAITGPVAKECADLWPRIASASGTVV
RHI10214|Rpl23-4     FLYFEDNAGVIVNPKGETEGYSAITGPVAKECADLWPRIASASGTVV
RHI10218|Rpl23       FLYFEDNAGVIVNPKGEMKG-SAITGPVAKECADLWPRIASASGTVV
ARA10155|RPL23A      FMYFEDNAGVIVNPKGEMKG-SAITGPIGKECADLWPRIASAANAIV
ARA10156|RPL23B      FMYFEDNAGVIVNPKGEMKG-SAITGPIGKECADLWPRIASAANAIV
ARA10157|RPL23C      FMYFEDNAGVIVNPKGEMKG-SAITGPIGKECADLWPRIASAANAIV
RIC10178|RPL23B      YMYFEDNAGVIVNPKGEMKG-SAITGPIGKECADLWPRIASAANAIV
RIC10179|RPL23A      YMYFEDNAGVIVNPKGEMKG-SAITGPIGKECADLWPRIASAANAIV
RIC10180|RPL23C      YMYFEDNAGVIVNPKGEMKG-SAITGPIGKECADLWPRIASAANAIV
GMA10284|LOC10078629 YMYFEDNAGVIVNPKGEMKG-SAITGPIGKECADLWPRIASAANAIV
GMA10285|LOC10081163 YMYFEDNAGVIVNPKGEMKG-SAITGPIGKECADLWPRIASAANAIV
GMA10286|LOC10079411 YMYFEDNAGVIVNPKGEMKG-SAITGPIGKECADLWPRIASAANAIV
GMA10287|LOC10030669 YMYFEDNAGVIVNPKGEMKG-SAITGPIGKECADLWPRIASAANAIV
POP10056|RPL23       FMYFEDNAGVIVNPKGEMKG-SAITGPIGKECADLWPRIASAANAIV
CRE10055|RPL23       YIYFEDNAGVIVNPKGEMKG-SAITGPVAKECADLWPRIASAANSIV
VOL10058|RPL23       YIYFEDNAGVIVNPKGEMKG-SAITGPVAKECADLWPRIASAANSIV
HEM10052|rpl23       FISFEDNAGIIANPKGELKG-SAITGPVAKECAELWPKIASTANCII
PTR10057|RPL23       FIHFEDSAGVIVNNKGEMKG-SAVSGPVAKECAELWPRIAANAGSIL
TPS10055|Rpl23-1     FIHFEDSAGVIVNNKGEMKG-SAVSGPVAKECAELWPRIASNAGSIV
TPS10056|Rpl23-2     FIHFEDSAGVIVNNKGEMKG-SAVSGPVAKECAELWPRIASNAGSIV
CYA10056|RPL23       YIMFEDNAGVIVNPKGEMKG-SAITGPVAKEAADIWPKIASAASAIA
DIC10055|RPL23       YIYFEDNAGVMCNPKGEVKG--NILGPVAKECSDLWPKVATNAGTIV
PLA10062|RPL23       YIYFEDNAGVIVNPKGEMKG-SAITGPVARECAELWPKLSSAASAIV
TGO10055|RPL23       FIYFEDNAGVVANNKGEMKG-SAVTGPVGKECAELWPKISAAATAIC
GIA10055|Rpl23       WIYFQDNAGVIINPKGELKG-SSITGPVAKEAADRWPKISTTAECVH