CLUSTAL W (2.1) Multiple Sequence Alignments
HUM10057|RPL23A      ----------------------------------------------------------------------------------------------------
DOG10056|Rpl23a      ----------------------------------------------------------------------------------------------------
MUS10056|Rpl23a      ----------------------------------------------------------------------------------------------------
RAT10056|LOC360572   ----------------------------------------------------------------------------------------------------
CHK10058|Rpl23a      ----------------------------------------------------------------------------------------------------
FUG10057|RPL23A      ----------------------------------------------------------------------------------------------------
DAN10056|Rpl23a      ----------------------------------------------------------------------------------------------------
MED10056|Rpl23a      ----------------------------------------------------------------------------------------------------
CIO10056|RPL23A      ----------------------------------------------------------------------------------------------------
DRO10077|RpL23A      MPPKKPTEKSAKPGDKKPEQKKTAAAPAAGKKEAAPSAAKPAAAAPKKAAAPAAKKAAPAAKKPATAGAAAKKPAAVKTTAAAKAKSKDAKKKVLAGKKP
MOS10057|Rpl23a      ----------------------------------------------------------------------------------------------------
BEE10058|Rpl23a      ----------------------------------MAPKSKPTDKSASKSAEKKTEKKIEKKPTTAASTSKVTKPTAKTSTTAKKATTAKSASSTKPTTKS
CEL10059|rpl-25.1    ----------------------------------------------------------------------------------------------------
CEL10060|rpl-25.2    ----------------------------------------------------------------------------------------------------
BMA10056|RPL23A      ----------------------------------------------------------------------------------------------------
STE10056|RPL23A      ----------------------------------------------------------------------------------------------------
MBR10056|RPL23A      ----------------------------------------------------------------------------------------------------
NEU10057|Rpl23a      ----------------------------------------------------------------------------------------------------
GRI10056|Rpl23a      ----------------------------------------------------------------------------------------------------
GRA10057|Rpl23a      ----------------------------------------------------------------------------------------------------
STA10056|Rpl23a      ----------------------------------------------------------------------------------------------------
YAR10057|Rpl23a      ----------------------------------------------------------------------------------------------------
POM10103|RPL23A      ----------------------------------------------------------------------------------------------------
POM10104|RPL23A-2    ----------------------------------------------------------------------------------------------------
YST10101|RPL25       ----------------------------------------------------------------------------------------------------
CIN10057|Rpl23a      ----------------------------------------------------------------------------------------------------
NEA10056|Rpl23a      ----------------------------------------------------------------------------------------------------
MAY10056|Rpl23a      ----------------------------------------------------------------------------------------------------
RHI10215|Rpl23a-2    ----------------------------------------------------------------------------------------------------
RHI10216|Rpl23a-3    ----------------------------------------------------------------------------------------------------
RHI10217|Rpl23a-4    ----------------------------------------------------------------------------------------------------
RHI10219|Rpl23a      ----------------------------------------------------------------------------------------------------
ARA10158|RPL23Aa     ----------------------------------------------------------------------------------------------------
ARA10159|RPL23Ab     ----------------------------------------------------------------------------------------------------
RIC10185|RPL23Ab     ----------------------------------------------------------------------------------------------------
RIC10186|RPL23Aa     ----------------------------------------------------------------------------------------------------
RIC10187|RPL23Aa     ----------------------------------------------------------------------------------------------------
GMA10288|LOC10052775 ----------------------------------------------------------------------------------------------------
GMA10289|LOC10077793 ----------------------------------------------------------------------------------------------------
GMA10290|LOC10078553 ----------------------------------------------------------------------------------------------------
GMA10291|LOC10077854 ----------------------------------------------------------------------------------------------------
GMA10292|LOC10077936 ----------------------------------------------------------------------------------------------------
GMA10293|LOC10050004 ----------------------------------------------------------------------------------------------------
POP10057|RPL23A      ----------------------------------------------------------------------------------------------------
CRE10056|RPL23A      ----------------------------------------------------------------------------------------------------
VOL10061|RPL23A      ----------------------------------------------------------------------------------------------------
HEM10051|rpl23A      ----------------------------------------------------------------------------------------------------
PTR10058|RPL23A      ----------------------------------------------------------------------------------------------------
TPS10057|Rpl23a      ----------------------------------------------------------------------------------------------------
CYA10057|RPL23A      ----------------------------------------------------------------------------------------------------
DIC10056|RPL23A      ----------------------------------------------------------------------------------------------------
PLA10064|RPL23A      ------------------------------------------------------------------------------------------MTQVEKKKKN
TGO10056|RPL23A      ----------------------------------------------------------------------------------------------------
GIA10056|Rpl23a      ----------------------------------------------------------------------------------------------------


HUM10057|RPL23A      ---------------------MAPKAKKEAPAPPKAEAKAKALKAKKAVLKG--VHSHKKKKIRTSPTFRRPKTLRLRRQPKYPRKSAPRRN-------K
DOG10056|Rpl23a      ---------------------MAPKAKKEAPAPPKAEAKAKALKAKKAVLKG--VHSHKKKKIRTSPTFRRPKTLRLRRQPKYPRKSAPRRN-------K
MUS10056|Rpl23a      ---------------------MAPKAKKEAPAPPKAEAKAKALKAKKAVLKG--VHSHKKKKIRTSPTFRRPKTLRLRRQPKYPRKSAPRRN-------K
RAT10056|LOC360572   ---------------------MAPKAKKEAPAPPKAEAKAKALKAKKAVLKG--VHSHKKKKIRTSPTFRRPKTLRLRRQPKYPRKSAPRRN-------K
CHK10058|Rpl23a      ---------------------MAPKAKKEAVP-PKTEAPSKALKAKKAVLKG--VFSHKKKKIRTSPTFRRPKTLRLRRQPKYPRKSAPRRN-------K
FUG10057|RPL23A      ---------------------MAPKAKKEVVP-VKTEAKSKALKAKKAVLKG--VHSQRRKKIRTSPTFRRPKTLRLRRQPKYPRKSAPRRN-------K
DAN10056|Rpl23a      ---------------------MAPKAKKEAVP-AKTEAKSKALKAKKAVLKG--VHSQKKKKIRTTPTFHRPKTLRLRRQPKYPRKSAPRRN-------K
MED10056|Rpl23a      ---------------------MAPKAKKEAVP-AKTEAKSKALKAKKAVLKG--VHSHKKKKIRTSPTFRRPKTLRLRRQPKYPRKSAPRRN-------K
CIO10056|RPL23A      --------------------------------MAVGGAKEKALRAKKAVLKG--LHSHRKKKFRKSVHFRLPKTLKLPRAPKYPRKSVAKRN-------K
DRO10077|RpL23A      QSVLAKLSAKARAAAKAKKGVKPVTKPAKGTAKAKAVALLNAKKVQKKIIKG--AFGTRARKIRTNVHFRRPTTLKLPRSPKYPRKSVPTRN-------R
MOS10057|Rpl23a      --------------------------------------MLRAKRASTKLVKG--PYGTCVRKIRTSVHFKRPKTLKLPRRPKYPRKSVAKRS-------R
BEE10058|Rpl23a      TAKPAPKVVAKPVVAKPKKNVQPAKKTPK--GGKPAVQLQKALKAQKKILKG--VHGSRVRKIRTSVHFYRPKTFRPPRNPKYARKSVPNRN-------R
CEL10059|rpl-25.1    ------------------------------MAPSAPAKTAKALDAKKKVVKG--KRTTHRRQVRTSVHFRRPVTLKTARQARFPRKSAPKTS-------K
CEL10060|rpl-25.2    -------------------------------MAPSSNKVGKAIQAKKAVVKG--SKTNVRKNVRTSVHFRRPKTLVTARAPRYARKSAPARD-------K
BMA10056|RPL23A      -------------MAPKRTSKKGSIGTDKAEKGTGKQKVAKALDAKKKVVKG--QFKVHKKGVRTSVHFHRPRTLTLPRSPRYPRKSVPRRD-------K
STE10056|RPL23A      ------------------MAKPKNYLVIKAKSSAKSAETGKAQKAKKAVQKG--VRAAKTKKVRTSVKFHRPKTLSLRRNPKYPRTSAPRIN-------K
MBR10056|RPL23A      -----------------------------------MAASQKAKSAQKAALAG--ASSKRTVKVRTSVNFHRPKTLKLARTPKYARQSQQKER-------K
NEU10057|Rpl23a      ---------------------MAPKDTKKGGASKAGKG-AQAKKAAQAALKG--VHSHKKTKVRYSTTFHRPKTLQLSRAPKYPRKSIPHEP-------R
GRI10056|Rpl23a      ---------------------MAPKDAKKGGASKAPKGSKQAQAASKAALKG--VHAHKRVKARYTTSFHRPKTLQLSRAPKYPRKSVPHLP-------R
GRA10057|Rpl23a      ---------------------MAAKDTK------GKKGGNKAAQAAKAALKG--TNSHKKVKARYSTSFHRPKTLITSRAPKYPRRSIPHQP-------R
STA10056|Rpl23a      --------------------------MGPKATTKTTKTGKQANAAAKSALRG--SYANKKRAIRKNTSFHRPKTLQLSRAPKYPRKSVPHEP-------R
YAR10057|Rpl23a      ------------------------------------MAATQAQNAKKAALKG--TNGSKTLKYRSSTIFRRPKVLELPKKPLYQRKAVAHYP-------R
POM10103|RPL23A      ------------------------------------MSVAKAKGAQKTVQKG--IHNKVAKKVRTSTTFRRPKTLQLSRKPKYARKSVAHAP-------R
POM10104|RPL23A-2    ------------------------------------MSVGKAKGAQKTVQKG--IHNKVARKVRTSTTFRRPKTLELARKPKYARKSVPHAS-------R
YST10101|RPL25       -----------------------------------MAPSAKATAAKKAVVKG--TNGKKALKVRTSATFRLPKTLKLARAPKYASKAVPHYN-------R
CIN10057|Rpl23a      ------------------------MATTKTTKGKTASKDAKAKSAKKAALQG--ANSHRSRKTRTSVSFYRPKTLRLARDPKYPRKSIPHAP-------R
NEA10056|Rpl23a      -----------------------MAPSKTAGKAAAKPQDVKAKAAKKAALKG--TQSTSVRKVRTSVTFHRPSTLRLPRAPKYPRKSVHHLP-------R
MAY10056|Rpl23a      ------------------------------MPAANKPQTTKATAAKKAALKG--TSGSKVRKVRTDTTFRRPKTLDLAKNPRFPRKSVPHAP-------R
RHI10215|Rpl23a-2    -------------------------------MPANSAPKAKAQAAKKAALKG--VHGKSVRKVRTTTHFHRPKTLVLKRAPKYARKSVAHAP-------R
RHI10216|Rpl23a-3    ---------------------------------MANQASTKALNAKKSALKG--VHSKSVRKVRTTTHFHRPKTLVLKRAPKYARKSVAHAP-------R
RHI10217|Rpl23a-4    ---------------------------------MANQASTKALNAKKSALKG--VHSKSVRKVRTTTHFHRPKTLVLKRAPKYARKSVAHAP-------R
RHI10219|Rpl23a      -------------------------------MPANSAPKAKAQAAKKAALKG--VHGKSVRKVRTTTHFHRPKTLVLKRAPKYARKSVAHAP-------R
ARA10158|RPL23Aa     ------------------------MSPAKVDTTKKADPKAKALKAAKAVKSG-QAFKKKDKKIRTKVTFHRPKTLTKPRTGKYPKISATPRN-------K
ARA10159|RPL23Ab     ------------------------MSPAKVDVTKKADPKAKALKAAKAVKSG-QIVKKPAKKIRTKVTFHRPKTLTVPRKPKYPKISATPRN-------K
RIC10185|RPL23Ab     -------------------------MAPKAAVKKADGKTQQALKVAKAVKSG--SIKRKSKKIRTSVTFHRPKTLKKARDPKYPRVSAPGRN-------K
RIC10186|RPL23Aa     -------------------------MAPKAAPAKKGDAKAQALKAAKAVKSG--TAKKTTKKIRTSVTFHRPKTLKKSRDPKYPRVSTPGRN-------K
RIC10187|RPL23Aa     -------------------------MAPKAAPAKKGDAKAQALKAAKAVKSG--TAKKTTKKIRTSVTFHRPKTLKKSRDPKYPRVSTPGRN-------K
GMA10288|LOC10052775 ------------------------MAPTKVDNAKRADPKAQALKTAKAVKSSGQVFRKKAKKIRTSVTFHRPRTLKKERNPKYPRISAPPRN-------K
GMA10289|LOC10077793 ------------------------MAPAKADNAKKADPKAQALKTAKAVKSGGQVFKKKAKKIRTSVTFHRPRTLKKERNPKYPRISAPPRN-------K
GMA10290|LOC10078553 -------------------------MAPKADSLKKADPKAQALKTAKAVKSG-ATLKKKTKKIRTSVTFHRPKTLKKDRNPKYPRISAPPRN-------K
GMA10291|LOC10077854 -------------------------MAPKADSSKKADPKAQALKTAKAVKSG-ANFKKKTKKIRTSVTFHRPRTLKKDRNPKYPRISAPPRN-------K
GMA10292|LOC10077936 -------------------------MAPKVD--KKNDPKAQALKTAKAVKSG-ATFKKKAKKIRTSVTFHRPRTLKKDRNPKYPRISAPPRN-------K
GMA10293|LOC10050004 -------------------------MAPKVD--KKNDPKAQALKTAKAVKSG-ATFKKKVKKIRTSVTFHRPKTLKKDRNPKYPRISAPPRN-------K
POP10057|RPL23A      ------------------------MSPAKADASRKPDPKAQAQKAARAVKSG-PTFKKT-KKIRTKVTFHRPRTLKKERNPKYPRISATPRN-------K
CRE10056|RPL23A      ------------------------MRDGNLALRGKADAKAVAAKAAKAVKKG---SFKKSRKPRFSVVFHRPKTLQRTREGKYPKISTPSLQ-------K
VOL10061|RPL23A      -----------------------------MAPKGKGDAKAVAAKAAKAVKKG---SFKKSRKPRFSVVFHRPKTLKRTREGKYPRISTPSLQ-------K
HEM10051|rpl23A      ------------------------------------------------MHSSENKLNLKKNTLKTSMKFFRPKTLKLKRNPRYEKKINVN-------LKK
PTR10058|RPL23A      --------------------------------------MSGKAAAVSKSLKKGISK--KGTRIHTKVHFYKPKTLKHDRKPKYQASSTPKK-------NT
TPS10057|Rpl23a      -----------------------------------MAGGAKAAAVAKKLTKSTKSK--KGTRIHTKVHFYRTQTLSLERKPKYARRSVPRK-------ST
CYA10057|RPL23A      -------------------------------MPRIRKGLAKTKAVAKVVRSG--STPKILAKAHEKVRFRKPKTRKLARAPKYPRKSAPATP-------W
DIC10056|RPL23A      --------MAGKKVKSNTPKQDLSVSKSKLTSIKAPAAAIKAKAAASAVKKG--VSNKSTRKVRTSVIFRRPVTLNNPKKPAYPRRSVNKIT-------K
PLA10064|RPL23A      VKNVNKHKIIHKRVIKKGNRKYTNGNTKVKYRKQVVKKTINKNVSKKKLLKENVDKDEKKKKMKISIRFKKPKTLIYARNPKCPRIVKSCHS------KT
TGO10056|RPL23A      --------------------------------MAPKAVAGKVKKAQQAAKGLKASSSFKKARVRTNVHFFRPHTLRKSRQPKVVRRCYEAATCTFPKLAK
GIA10056|Rpl23a      -----------------------------------MSEKAQALKAQKAILHG---TRVEAKKIRTNVHFFRPKTLVHKKAPLYPRNPIKKGS-------W


HUM10057|RPL23A      LDHYAIIKFPLTTESAMKKIEDNNTLVFIVDVKANKHQIKQAVKKLYDIDVAKVNTLIRPDGEKKAYVRLAPDYDALDVANKIGII-
DOG10056|Rpl23a      LDHYAIIKFPLTTESAMKKIEDNNTLVFIVDVKANKHQIKQAVKKLYDIDVAKVNTLIRPDGEKKAYVRLAPDYDALDVANKIGII-
MUS10056|Rpl23a      LDHYAIIKFPLTTESAMKKIEDNNTLVFIVDVKANKHQIKQAVKKLYDIDVAKVNTLIRPDGEKKAYVRLAPDYDALDVANKIGII-
RAT10056|LOC360572   LDHYAIIKFPLTTESAMKKIEDNNTLVFIVDVKANKHQIKQAVKKLYDIDVAKVNTLIRPDGEKKAYVRLAPDYDALDVANKIGII-
CHK10058|Rpl23a      LDHYAIIKFPLTTESAMKKIEDNNTLVFIVDVKANKHQIKQAVKKLYDIDVAKVNTLIRPDGEKKAYVRLAPDYDALDVANKIGII-
FUG10057|RPL23A      LDHYAIIKFPLTTESAMKKIEDNNTLVFIVDFKPNKHQIKHAVKKLYDIDVAKVNTLIRPDGEKKAYVRLAPDYDALDVANKIGII-
DAN10056|Rpl23a      LDHYAIIKFPLTTESAMKKIEDNNTLVFIVDVKANKHQIKHAVKKLYDIDVAKVNTLIRPDGEKKAYVRLAPDYDALDVANKIGII-
MED10056|Rpl23a      LDHYAIIKFPLTTESAMKKIEDNNTLVFIVDVKANKHQIKHAVKKLYDIDVAKVNTLIRPDGEKKAYVRLAPDYDALDVANKIGII-
CIO10056|RPL23A      MDQFAVVKHPLTTESAMKKIEDNNTLVFIVDLKANKPQIKQAVKKLYDIDVAKVNTLIRPDGRKKAYVKLAPDYDALDVANKIGII-
DRO10077|RpL23A      MDAYNIIKYPLTTEAAMKKIEDNNTLVFLTHLRANKNHVRAAVRKLYDIKVAKVNVLIRPDGQKKAYVRLARDYDALDIANKIGII-
MOS10057|Rpl23a      MDAYNIIKYPLTTEAAMKKIEDNNTLVFLIHLRANKNHVKAAVRKLYDVKVLKINTLVRPDGKKKAYVRLTRDYDALDIANKIGII-
BEE10058|Rpl23a      MDAFNIIKFPLTTEAAMKKIEDNNTLVFIVHTRANKYHIKASIKKLYDVDVAKVNTLIRPDGKKKAYVRLTRDYDALDVANKIGII-
CEL10059|rpl-25.1    MDHFRIIQHPLTTESAMKKIEEHNTLVFIVSNDANKYQIKDAVHKLYNVQALKVNTLITPLQQKKAYVRLTADYDALDVANKIGVI-
CEL10060|rpl-25.2    LDSFAVIKAPHTTESSMKKIEDHNTLVFIVDEKANKHHIKRAVHALYNVKAVKVNTLITPLQQKKAYVRLASDYDALDVANKIGFI-
BMA10056|RPL23A      LDAYAIIKHPLTTESAMKKIEDTNTLVFIVDIKSNKPQIRLAVKKLYNIDVQKVNTLITPNHEKKAYVRLAPDYDALDVANKIGII-
STE10056|RPL23A      LDHYAIIKHPLTTESAMKKIEDNNTLVFIVDVRANKPQIKAAVKKLYDIVVSKVNTLVRPDGQKKAYVRLAPDYDALDVSNKIGII-
MBR10056|RPL23A      LDEYTVVQHPLTTESAMKKIEDHNTLVFIVDRRSNKGSIKQAIEKRYGITVAKVNTLVRPDGKKKAYVRLSADADALEVANKIGII-
NEU10057|Rpl23a      LDEHKVIVHPLNTEGALKKIEEQNTLVFIVDVKANKAQIKQALKKLYDIDTVKINTLIRPDGSKKAFARLTADVDALDIAATKLGLV
GRI10056|Rpl23a      LDEHKIIVHPLNTESAMKKIEENNTLVFIVDIKANKAQIKQALKKLYDLDVLKINTLIRPDGQKKAYVRLTPDVDALDIAATKLALV
GRA10057|Rpl23a      LDEHKVVIHPLNTESAMKKMEENNTLVFIVDVKANKAQIKLALKKLYDIDCLKINTLIRPDGSKKAYARLTPDVDALDIAANKLSLV
STA10056|Rpl23a      MDASKVLIHPLNTESAMKKIEENNTLVFIVDVKANKRQIAAALKKQYDVSCVKINTLIRPDGSKKAFARLTADVDALDIAATKLAIV
YAR10057|Rpl23a      MDSYDVIISPLNTETAMKKIEDSNTLVFIVNKKANKYQIRDAIKKLYEVEIASVNTLIRPDGKKKAFVRLTADHDALDIANKIGYI-
POM10103|RPL23A      LDEYKIIVNPINSESAMKKIEDDNTLVFHVHLKANKFTIKEAVRKLYSVEPVKINTLIRPNGTKKAFVKLSADADALDVANRIGFL-
POM10104|RPL23A-2    LDEYKIIVNPINSESAMKKIEDDNTLVFHVHLKANKFTIKNAVKKLYSVDAVKINTLIRPNGTKKAFVKLSADADALDVANRIGFL-
YST10101|RPL25       LDSYKVIEQPITSETAMKKVEDGNILVFQVSMKANKYQIKKAVKELYEVDVLKVNTLVRPNGTKKAYVRLTADYDALDIANRIGYI-
CIN10057|Rpl23a      MDQFRTIVSPLNTESAMKKIEEHNTLVFIVDVKANKRQIKDAVKKLYDVQAAKINTLIRPDGKKKAYVRLTADHDALDVANKIGFI-
NEA10056|Rpl23a      MDQFRTIQHPLNTESAMKKIEEHNTLVFIVDIKANKRNIKDAVKKLYDVEAAKVNTLIRPDGRKKAYVRLTADFDALEVANKIGFI-
MAY10056|Rpl23a      MDAFRTILFPLNTESAMKKIEENNTLVFIVDRAANKRQIEGALKKLYDVSAAKINTLIRPDGKKKAFVRLTPDQDALDVSNRIGFI-
RHI10215|Rpl23a-2    MDQYRIVRQPLNTETAMKKIEEHNTLTFLVDVKANKHQIKDAVKRLYDVEVAAVNTLITTSGNKKAFVRLTADVDALDVANKIGFI-
RHI10216|Rpl23a-3    MDQYRIVRQPLNTETAMKKIEEHNTLTFLVDVKANKHQIKDAVKRLYDVEVATVNTLITTSGNKKAFVRLTADVDALDVANKIGFI-
RHI10217|Rpl23a-4    MDQYRIVRQPLNTETAMKKIEEHNTLTFLVDVKANKHQIKDAVKRLYDVEVATVNTLITTSGNKKAFVRLTADVDALDVANKIGFI-
RHI10219|Rpl23a      MDQYRIVRQPLNTETAMKKIEEHNTLTFLVDVKANKHQIKDAVKRLYDVEVAAVNTLITTSGNKKAFVRLTADVDALDVANKIGFI-
ARA10158|RPL23Aa     LDHYQILKYPLTTESAMKKIEDNNTLVFIVDIRADKKKIKDAVKKMYDIQTKKVNTLIRPDGTKKAYVRLTPDYDALDVANKIGII-
ARA10159|RPL23Ab     LDHYQILKYPLTTESAMKKIEDNNTLVFIVDIRADKKKIKDAVKKMYDIQTKKVNTLIRPDGTKKAYVRLTPDYDALDVANKIGII-
RIC10185|RPL23Ab     LDQYQILKYPLTTESAMKKIEDNNTLVFIVDLKADKKKIKAAVKKMYDIQAKKVNTLIRPDGKKKAYVKLTPDYDALDVANKIGII-
RIC10186|RPL23Aa     LDQYQILKYPLTTESAMKKIEDNNTLVFIVDLKADKKKIKAAVKKMYDIQAKKVNTLIRPDGKKKAYVKLTPDYDALDVANKIGII-
RIC10187|RPL23Aa     LDQYQILKYPLTTESAMKKIEDNNTLVFIVDLKADKKKIKAAVKKMYDIQAKKVNTLIRPDGKKKAYVKLTPDYDALDVANKIGII-
GMA10288|LOC10052775 LDHYQILKFPLTTESAMKKIEDNNTLVFIVDLRANKKKIKDAVKKMYDIQAKKVNTLIRPDGTKKAYVRLTPDYDALDVANKIGII-
GMA10289|LOC10077793 LDHYQILKFPLTTESAMKKIEDNNTLVFIVDLRADKKKIKDAVKKMYDIQAKKVNTLIRPDGTKKAYVRLTPDYDALDVANKIGII-
GMA10290|LOC10078553 LDHYQILKYPLTTESAMKKIEDNNTLVFIVDLRADKKKIKDAVKKMYDIQTKKVNTLIRPDGTKKAYVRLTPDYDALDVANKIGII-
GMA10291|LOC10077854 LDHYQILKFPLTTESAMKKIEDNNTLVFIVDLRADKKKIKDAVKKMYDIQAKKVNTLIRPDGTKKAYVRLTPDYDALDVANKIGII-
GMA10292|LOC10077936 LDHYQILKYPLTTESAMKKIEDNNTLVFIVDLRADKKKIKDAVKKMYDIQAKKVNTLIRPDGTKKAYVRLTPDYDALDVANKIGII-
GMA10293|LOC10050004 LDHYQILKYPLTTESAMKKIEDNNTLVFIVDLRADKKKIKDAVKKMYDIQAKKVNTLIRPDGTKKAYVRLTPDYDALDVANKIGII-
POP10057|RPL23A      LDHYQILKYPLTTESAMKKIEDNNTLVFIVDIRADKKKIKDAVKKMYDIQTKKVNTLIRPDGTKKAYVRLTPDYDALDVANKIGII-
CRE10056|RPL23A      LDQYAVLKFPLTTESAMKKIEDNNTLVFIVDLKASKKQIKDAVSRMYDVQTKKVNTLIRPDGQKKAYVCLTADYDALDVANKIGII-
VOL10061|RPL23A      LDQYAVLKYPLTTESAMKKIEDNNTLVFIVDLKANKKQIKEAVQRMYDIQTKKVNTLIRPDGQKKAYVCLTADYDALDVANKIGII-
HEM10051|rpl23A      KEQFRTIYFPLTTESALKEIQAGNTLVFIVNPKSNKNQIKNSVKKLYKVKIKKINTLIDLNGKKKAFVKLTSDYDALDVANKIGFI-
PTR10058|RPL23A      LDKHSIIKYPLTTESSMKLIEDSNTLVFIVDIKANKRQIKAAVRDLYNIECEKVNTLITPRGLKKSYVRLSKDHDALDVANRVGVI-
TPS10057|Rpl23a      VDKYSIIKYPLTTESSMKLIEDSNTLVFIVDIKANKRQIKQAVKDLYQIECEKVNTLITPRGLKKSYVRLSKDFDALDVANRVGVI-
CYA10057|RPL23A      IDEFGVIKHPLTTESAMKLMEDHNTLVFIVDVRSDKRKIRQAVAKLYGVQASKVNTLIRPDGKKKAFVRLAANYDALDVANKIGII-
DIC10056|RPL23A      MDQFRILKAPLTTESATQKIEGSNTITFMVDMFANKSQVADAVAKMYDVKVKRVNTLITPRGEKKAFVTLSPEFEAADVANKIGLI-
PLA10064|RPL23A      LDKYGLIKYPLTSEKAMKKIEEINTLVFMCDKRANKKNIKKSVKNLFGIECDKVNVLNTLNGDKKAYVRLSGEHDALEVANKIGIL-
TGO10056|RPL23A      TDKYTIVRQPLTTESAMKKIEETNTLVFLVDPRSNKRQIKQAVKELYDVDTQRVNTLIRPDGLKKAYVRLTSDYDALDVANKIGII-
GIA10056|Rpl23a      DDPCDLLRYPIKTDENTTQIEKNNTIVFIVDRRASKPEIRKAFETVFETKVARVNTLITPLGLKKAFIRLAPDVQAMDVASKMGLA-