CLUSTAL W (2.1) Multiple Sequence Alignments
HUM10058|RPL24       -------MKVELCSFSGYKIYPGHGRRYARTDGKVFQFLNAKCES-AFLSKRNPRQINWTVLYRRKHKKGQS--EEIQKKRTRRAVKFQ-RAITGASLAD
DOG10057|Rpl24       -------MKVELCSFSGYKIYPGHGRRYARTDGKVFQFLNAKCES-AFLSKRNPRQINWTVLYRRKHKKGQS--EEIQKKRTRRAVKFQ-RAITGASLAD
MUS10057|Rpl24       -------MKVELCSFSGYKIYPGHGRRYARTDGKVFQFLNAKCES-AFLSKRNPRQINWTVLYRRKHKKGQS--EEIQKKRTRRAVKFQ-RAITGASLAD
RAT10057|Rpl24       -------MKVELCSFSGYKIYPGHGRRYARTDGKVFQFLNAKCES-AFLSKRNPRQINWTVLYRRKHKKGQS--EEIQKKRTRRAVKFQ-RAITGASLAD
CHK10059|Rpl24       -------MKVELCSFSGYKIYPGHGRRYARTDGKVFQFLNAKCES-AFLSKRNPRQINWTVLYRRKHKKGQS--EEIQKKRTRRAVKFQ-RAITGASLAE
FUG10058|RPL24       -------MKVELCSFSGYKIYPGHGRRYARIDGKVFQFLNAKCES-AFLAKRNPRQINWTVLYRRKHKKGQS--EEVTKKRTRRAVKFQ-RAITGASLAE
DAN10057|Rpl24       -------MKVELCSFSGYKIYPGHGRRYARIDGKVFQFLNAKCES-AFLSKRNPRQINWTVLYRRKHKKGQS--EEVSKKRTRRAVKFQ-RAITGASLAE
MED10057|Rpl24       -------MKVELCSFSGYKIYPGHGRRYARIDGKVFQFLNAKCES-AFLAKRNPRQINWTVLYRRKHKKGQS--EEVTKKRTRRAVKFQ-RAITGASLAE
CIO10057|RPL24       -------MRTELCQFSGLKIYPGHGKRYIRIDGKSFNLLSGKCQA-LLLAKKNPRKICWTVLYRRKHKKGTQ--EEVTKKRTRRNVKFQ-RAIQGASWGE
DRO10078|RpL24       -------MKIGLCAFSGYKIYPGHGKTMVKIDGKSFTFLDKKCER-SYLMKRNPRKVTWTVLYRRKHRKGIE--EEASKKRTRRTQKFQ-RAIVGASLAE
MOS10058|Rpl24       -------MKIGLCAFSGFKIYPASGKTLVKADGKTFTFLNKKCER-SFLMKRNPRKVKWTVLYRRKHKKGIV--EEAAKKRTRRTQKFQ-RAIVGASLSD
BEE10059|Rpl24       -------MKIGLCAYSGYKIYPGHGKTMVKVDGKTFTFLNSKCES-AHLMRRNPRKVTWTVLYRRKHKKGQE--EEQAKKRTRRTQKFQ-RAIVGASLTD
CEL10061|rpl-24.1    -------MKVETCVYSGYKIHPGHGKRLVRTDGKVQIFLSGKALK-GAKLRRNPRDIRWTVLYRIKNKKGTHGQEQVTRKKTKKSVQVVNRAVAGLSLDA
BMA10057|RPL24       -------MKLETCVYSGYKIYPGHGKRMVRADGKVQIFLNKKCLR-SYKLKRNPRDIPWTVLYRRKHKKGVHGEENAQKKRTRRVIQIASRAVGNVSLEA
STE10057|RPL24       -------MKLELCNYSGYKIYPGHGKRYVRQDGKVFNFLNKRCER-ALLMRRNPREVTWTVLYRRKHKKGTQ--EEVSKKRTRRNIKFQ-RSVQGASLDN
MBR10057|RPL24       -------MKLELCSFSSYKIHAGHGRRLVRVDGKTFYFLGSKVES-LFLQRKNPRKIAWTVLYRRKHRKGLS--EETTKRRTRRTQKFQ-RAIEGVSEEK
NEU10058|Rpl24       -------MRTYDDTFSGQRIYPGKGKLYVRGDSKIFRFQNGKSES-LFLQRKNPRRIAWTVLYRRQHKKGIS--EEVAKKRSRRTVKAQ-RAIVGASLEV
GRI10057|Rpl24       -------MRTYDDTFSGQRIYPGKGKLYVRGDSKIFRFQNGKSES-LFLQRKNPRRIAWTVLYRRAHRKGIS--EEVAKKRTRRTVKSQ-RAIVGASLDV
GRA10058|Rpl24       -------MRTYEDTFSGARIYPGKGKLYVRGDSKIFRFQNGKSES-LFLQRKNPRRIAWTVLYRRQHRKGIS--EEVAKKRTRRTVKAQ-RGIVGASLDV
STA10057|Rpl24       -------MRTYDDSFSGQKIYPGKGKLYIRGDSKIFRFQNGKTES-LFLQRKNPRKISWTTLYRRMHKKGIS--EEVAKKRTRRTVKHQ-RAIVGASLDV
YAR10058|Rpl24       -------MKIELDSFSGNKIYPGRGTLFVRGDSKIFRFYSSKTAS-LFKQRKNPRRIAWTVLYRRKHKKGIT--EEVSKKRSRKSVKAV-RGIVGASLDV
POM10100|RPL24       -------MKVEVCSFSGSKVYPGAGRLFVRGDNKVFRFVNKKSES-LFLQRKNPRRLSWTVLYRRMHKKGIS--EEHAKKRTRRTVKHQ-RGIVGANLDV
POM10101|RPL24-2     -------MKVEVCSFSGSKVYPGAGRLFVRGDNKVFRFVNKKSES-LFLQRKNPRRLSWTVLYRRMHKKGIS--EEHAKKRTRRTVKHQ-RGIVGANLDV
POM10102|RPL24-3     -------MRVHTCYFCSGPVYPGHGIMFVRNDSKVFRFCRSKCHK-NFKMKRNPRKVAWTKAYRKAHGKEMVYDTALAVTAARR--NVPVRYDRNVIATT
YST10102|RPL24A      -------MKVEIDSFSGAKIYPGRGTLFVRGDSKIFRFQNSKSAS-LFKQRKNPRRIAWTVLFRKHHKKGIT--EEVAKKRSRKTVKAQ-RPITGASLDL
YST10103|RPL24B      -------MKVEVDSFSGAKIYPGRGTLFVRGDSKIFRFQNSKSAS-LFKQRKNPRRIAWTVLFRKHHKKGIT--EEVAKKRSRKTVKAQ-RPITGASLDL
CIN10058|Rpl24       -------MKVEIDSFSGYRIYPSKGKLFVRGDSKVFRFSGSKSAS-LFLQRKNPRKIAWTQVYRRMHKKGLT--EEVTKRKSRKTVKHQ-RGIVGADLAA
NEA10057|Rpl24       -------MRVDRCDFTGYKVYPSRGKVYVRGDSKTFRFLSAKAES-LFLQRKNPRKIAWTQVYRRMHKKGIT--EEVAKKRSRKNVKVQ-RGIVGADLAS
MAY10057|Rpl24       -------MKVEICAFSQRKIYPGKGRLYVRGDNKVFRFVSSKNES-LFLQRKNPRKIAWTVVYRRLHKKGVT--EEVAKKRSRKTVKHQ-RGIVGASLEQ
RHI10220|Rpl24       -------MKLEICSFSGQKIYPAKGKTYVRIDSKTFRFINGKTES-YFLQRLNPRKIRWTAIYRRLNKKGMT--EEVQKKRSRRTVKHE-RAVVGASWDA
RHI10221|Rpl24-2     -------MKLEICSFSGQKIYPAKGKTYVRIDSKTFRFINGKTES-YFLQRLNPRKIRWTAIYRRLNKKGMT--EEVQKKRSRRTVKHE-RAVVGASWDA
RHI10222|Rpl24-3     -------MKLEICSFSGQKIYPAKGKTYVRIDSKTFRFINGKTES-YFLQRLNPRKIRWTAIYRRLNKKGMT--EEVQKKRSRRTVKHE-RAVVGASWDA
RHI10223|Rpl24-4     -------MKLEICSFSGQKIYPAKGKTYVRIDSKTFRFINGKTES-YFLQRLNPRKIRWTAIYRRLNKKGMT--EEVQKKRSRRTVKHE-RAVVGASWDA
ARA10160|RPL24A      -----MVLKTELCRFSGQKIYPGRGIRFIRSDSQVFLFLNSKCKR-YFHNKLKPSKLCWTAMYRKQHKKDAA--QEAVKRRRRATKKPYSRSIVGATLEV
ARA10161|RPL24B      -----MVLKTELCRFSGQKIYPGRGIRFIRSDSQVFLFLNSKCKR-YFHNKLKPSKLAWTAMYRKQHKKDAA--QEAVKRRRRATKKPYSRSIVGATLEV
RIC10188|RPL24A      -----MVLKTELCRFSGQKIYPGKGIRFIRADSQVFLFANSKCKR-YFHNRLKPAKLTWTAMYRKQHKKDIH--AEAVKKRRRTTKKPYSRSIVGATLEV
RIC10189|RPL24A      -----MVLKTELCRFSGQKIYPGKGIRFIRADSQVFLFANSKCKR-YFHNRLKPAKLTWTAMYRKQHKKDIH--AEAVKKRRRTTKKPYSRSIVGASLEV
RIC10190|RPL24A      -----MVLKTELCRFSGAKIYPGKGIRFIRADSQVFLFSNSKCKR-YFHNRLKPAKLTWTAMYRKQHKKDIH--AEAVKKRRRTTKKPYSRSIVGATLEV
RIC10191|RPL24B      -------MRLEKCWFCSSTIYPGHGIQFVRNDAKIFRFCRSKCHK-NFKMKRNPRKVKWTKAYRCLHGKDMTQDSTFEFERKR---NRPERYDRNVTAQT
RIC10192|RPL24B      -------MRLEKCWFCSSTVYPGHGIQFVRNDAKIFRFCRSKCHK-NFKMKRNPRKVKWTKAYRCLHGKDMTQDSTFEFERKR---NRPERYDRNVTEQT
GMA10294|LOC10049997 -----MVLKTELCRFSGAKIYPGKGIRFVRGDSQVFLFANSKCKR-YFHNRLKPSKLTWTAMYRKQHKKDIA--QEAVKKRRRAAKKPYSRSIVGATLEV
GMA10296|LOC10049972 -----MVLKTELCRFSGAKIYPGKGIRFVRGDSQVFLFANSKCKR-YFHNRLKPSKLTWTAMYRKQHKKDIA--QEAVRKRRRAAKKPYSRSIVGATLEV
GMA10297|LOC10049988 -----MVLKTELCRFSGAKIYPGKGIRFVRGDSQVFLFANSKCKR-YFHNRLKPSKLTWTAMYRKQHKKDIA--QEAVKKRRRATKKPYSRSIVGATLEV
GMA10298|LOC10079176 -----MVLKTELCRFSGAKIYPGKGIRFVRGDSQVFLFANSKCKR-YFHNRLKPSKLTWTAMYRKQHKKDIA--QEAVKKRRRAAKKPYSRSIVGATLEV
POP10058|RPL24       -----MVLKTELCRFSGAKIYPGRGIRFIRSDSQVFLFANSKCKR-YFHNKLKPSKLTWTAMYRKQHKKDIA--AETVKKRRRTTKKPYSRSIVGATLEV
CRE10057|RPL24       -----MVLKTNTCRFSGLRIYPGKGMIFIRTDGQHYMFLNKKCKS-YYHNRLRPAKLAWTVTYRKQHKKDQI--SEVQKKKRRTAAKSNNRSIVGTSLEV
VOL10062|RPL24       -----MVLKTNTCRFSGLRIYPGKGLLFIRTDGQQYMFLNKKCKS-YYHNRLRPAKLAWTVTYRKQHKKDQV--SEVQKKKRRAVAKSANRSIVGASLEV
HEM10068|rpl24       -------MDLKKCSVCGFCIYPGHGSVLVKNNLKIFRFCRSRCRK-LYALKKNPIFLKWTSVGRTIRGLKVNLKNNFLKNDSNSFLFMRKNYNFLLGLQT
PTR10059|RPL24       -----MVINTELCALSEYRIYPGNGKLMIRRDGKPIWLGSSKAFS-LTVQRKKAAKLVWTQAWRRLHKKGLS--ETTTKKR-SRRAGKVQRAVVGASLED
TPS10058|Rpl24       -------MRSELCAMSEYRIWPGTGKLFIRRDGKPIFLGSSKAQS-LTLQRKKPAKLVWTQAWRRLHKKGLS--ETNLKKR-RTRTNKVQRAVVGLSLED
CYA10058|RPL24       -----MVVRTQICNFSGFRIYPGHGSTFVRSDGKVFVFANSKCKS-SFHMRRKPASLNWTYIYRRLHRKGQE--EQEKRRTRRRAVKTVQKPVEGASIEV
DIC10057|RPL24       -------MKTSLCNYSEFKIYPARGMKFVRGDSKVFHFINTKVES-LFFRKINPRDIRWSMVYRRIYKNTTT---DVSAKKKARKTKKVERNIVGASLEV
PLA10065|RPL24       MSQIKTTVKTEACSFSEYRIYPGRGQKYIARDGKVYFYLSSKFAS-LALQKKKAAKLRWTQTWRRNNKKTKI--ETTQRRR-YKKTIKVQKAVCGLTVED
TGO10057|RPL24       MSAVKTTIKTDMCSFSEYRIYPGRGQRFVAKDGKVHTFIHRKEAS-LFRQKIKPVKLHWTLVWRRMNKKGGK--DAVNKRRSRKATKTVQKAIVGLSLED
GIA10057|Rpl24       ------MPRIEHCSFCSKPVYPGKGICFVRNDSRVFRFCTSKCHR-NFKMKRNPRKVRWTKTYRLLHNKDMATDTTYDFERRR---NRAVKYDRNLWEKA
HAL10050|VNG1159G    ------MVQTRSCDYCGDDIEPGTGTMFVHNDGSTVHFCSAKCEK-NADLGREPRDVEWTDEEEVEETQ-------------------------------
MET10049|MJ1201      ------MPEWRTCSFCGYEIEPGKGKMVVEKDGTVLYFCSSKCEK-SYRMGRNPRKLKWTKVYQDMKAELKKAQESQ-----------------------
PYR10050|PH1495a     ------LARWNICSYCGKPFEPGTGKMYVRNDGRVLFFCSRKCER-YYFMGRNPRKLKWTKAYQEARLQRGKR---------------------------
SUL10058|STS039      ------MPSIKQCSFCGKEIPPATGLMYIRNDGSILWFCSNKCKKSMLKLHRDPKKLKWTKSYIGGK---------------------------------


HUM10058|RPL24       IMAKRNQ-KPEVRKAQREQAIRAAKEAKKAKQASKKTAMAAAKAPTKAAPKQKIVKPVKVSAPRVGGKR-------------------------------
DOG10057|Rpl24       IMAKRNQ-KPEVRKAQREQAIRAAKEAKKAKQASKKTAMAAAKAPTKAAPKQKIVKPVKVSAPRVGGKR-------------------------------
MUS10057|Rpl24       IMAKRNQ-KPEVRKAQREQAIRAAKEAKKAKQASKKTAMAAAKAPTKAAPKQKIVKPVKVSAPRVGGKR-------------------------------
RAT10057|Rpl24       IMAKRNQ-KPEVRKAQREQAIRAAKEAKKAKQASKKTAMAAAKAPTKAAPKQKIVKPVKVSAPRVGGKR-------------------------------
CHK10059|Rpl24       IMAKRNQ-KPEVRKAQREQAIRAAKEAKKAKQATKKTAVSAAKAPTKAAPKQKIVKPVKVSAPRVGGKR-------------------------------
FUG10058|RPL24       IMAKRNQ-KPEVRKAQREQAIRAAKEAKKAKQAAKKPAAPQAKASTKTAQKPKIAKPMKISAPRVGGKR-------------------------------
DAN10057|Rpl24       ILAKRNQ-KPEVRKAQREQAIRAAKEAKKAKQATKKQTTQSSKAPAKSAQKQKIAKPMKVSAPRVGGKR-------------------------------
MED10057|Rpl24       IMAKRNQ-KPEVRKAQREQAIRAAKEAKKAKQAAKKPATAAAKSSAKAAQKPKIAKPMKVSAPRVGGKR-------------------------------
CIO10057|RPL24       IVAKRNQ-KPAVRKAARDQAIKAAKEKKKSAEQAKKVQKAAKPAGQKSKATKNVR----ASAPRVGGKR-------------------------------
DRO10078|RpL24       ILAKRNM-KPEVRKAQRDQAIKVAKEQKRAVKAAKKAAAPAP--AKKSAPKQKAAKVTQKAAPRVGGKR-------------------------------
MOS10058|Rpl24       IMAKRNM-KPEVRKAQREQAIKAAKEAKKAKQTDKKPKAAQP--NPKQQ-KTKAAKVAQKAAPRVGGKR-------------------------------
BEE10059|Rpl24       ILAKRNM-KPEIRKAQREQAIKAAKEQKKAAKATKKAVVPP---KTKAIPKHKAAKITQKSAPRVGGKR-------------------------------
CEL10061|rpl-24.1    ILAKRNQ-TEDFRRQQREQAAKIAKDANKAVRAAKAAANKEKKASQPK-TQQKTAKNVKTAAPRVGGKR-------------------------------
BMA10057|RPL24       ILAKRNQ-KPEFRREQREQAIKAAKEAARASKSEKKAANKALKEKKAAPQKMKIPKPTKTQQPRVGGKR-------------------------------
STE10057|RPL24       ILAKRNQ-KPEVRKAQREQAIRAAKEKQR-AKASTKKPTTAQPAAQRQKAQKNVKQ--MAAKPRVGGKR-------------------------------
MBR10057|RPL24       LRELRQQ-KPEVRAAARQQAARAAK---EKKQTQKKVATKKPKANAQAVASFKAVKNVPKKLNRSTGR--------------------------------
NEU10058|Rpl24       IKERRSM-RPEARSAARLAAIKESKAKKQETQAAKKAEKAKNAAN----PKARVTSKQGAKGAPVKVAAKSR----------------------------
GRI10057|Rpl24       IKERRTM-RPEARSAARAAAIKESKAKKAEAEKAKKAEKAKVAGGK--GQTGRLTSKQGAKGAQQKVAANTR----------------------------
GRA10058|Rpl24       IKEKRNI-RPEARSAARAQAIKESKEKKQAEAATKKSEKAKLAAQASKGQAVRQVSKQGAKGSAPKVQAKTR----------------------------
STA10057|Rpl24       IKERRSQ-RPEARAAARSAAVQEGKEKKAAAESKKKAEKAKSASSAARGQASKIQSKQGSKGAAPKVQASGRR---------------------------
YAR10058|Rpl24       IKEKRNA-RPETRNATRAKHAEAAKERKEKEAERRKAAKAAHVAAG-----GPKVSKLGAKGSAPKVQATSR----------------------------
POM10100|RPL24       IKEKRNQ-RPEVRAAARAAALKQRKDKKAASESEKKAIKAKSAASSARGQAIKNAKAAARH---------------------------------------
POM10101|RPL24-2     IKEKRNQ-RPEVRAAARAAALKQRKDKRAASESEKKAIKAKSAASSARGQAIKNAKVAARR---------------------------------------
POM10102|RPL24-3     LNAMKRVSQVHAKRERLFYKKRLAGKRAQELQEAQKLIAQNVPQFTEPEGEVETAEVQEPQIVSDEEYTMEEEVAEPVKIPVLAKKRKNKKSRNSSSAMQ
YST10102|RPL24A      IKERRSL-KPEVRKANREEKLKANKEKKKAEKAARKAEKAKSAGTQ-----SSKFSKQQAKGAFQKVAATSR----------------------------
YST10103|RPL24B      IKERRSL-KPEVRKANREEKLKANKEKKRAEKAARKAEKAKSAGVQ-----GSKVSKQQAKGAFQKVAATSR----------------------------
CIN10058|Rpl24       IAAKRNQ-TAAVREQQRLAAIAKAKSEKKERESKKAKVRSNFPAVRQSIPSGPKVSKQQMKGGKAGR---------------------------------
NEA10057|Rpl24       ILAKRTA-KPEVRAAARQAAITKAKTEKRDKEARKAAN-------KPAQANVPKVSKQSMKGGAGKGGR-------------------------------
MAY10057|Rpl24       INARRNQ-KPEVRAAARQAAVAKSKEDKKAKAEVRKAN---KVKSLGAGGAGPQVSRQQMKGGAGKVRV-------------------------------
RHI10220|Rpl24       IRAKRNQ-KPDARAAARQAAIAKSKEAKKTAAAAKKANPS--------AASQSKVSKQQAKGFAPKAAATSR----------------------------
RHI10221|Rpl24-2     IRAKRNQ-KPDARAAARQAAIAKSKEAKKSAAAAKKANPS--------AASQSKVSKQQAKGFAPKAAATSR----------------------------
RHI10222|Rpl24-3     IRAKRTQ-KPDARAAARQAAIAKSKEAKKTAAAAKKANP---------AASQPKVSKQQAKGFAPKAAATSR----------------------------
RHI10223|Rpl24-4     IRAKRNQ-KPDARAAARQAAIAKSKEAKKTAAAAKKANP---------AASQPKVSKQQAKGFAPKAAATSR----------------------------
ARA10160|RPL24A      IQKKRAE-KPEVRDAAREAALREIKERIKKTKDEKKAKKVEYASKQQKSQVKGNIPKSAAPKAAKMGGGGGRR---------------------------
ARA10161|RPL24B      IQKKRAE-KPEVRDAAREAALREIKERIKKTKDEKKAKKVEFASKQQKVKAN-FPKAAAASKGPKVGGGGGKR---------------------------
RIC10188|RPL24A      IQKKRSE-KPEVRDAAREAALREIKERIKKTKDEKKAKKAEVAK-SQKTQSKGGATQRGA-KGPKIGGGGGKR---------------------------
RIC10189|RPL24A      IQKKRAE-KPEVRDAAREAALREIKERIKKTKDEKKAKKAEVTK-SQKSQSKG-AAPRGS-KGPKIGGGGGKR---------------------------
RIC10190|RPL24A      IQKKRAE-KPEVRDAARESALREIKERIKKTKDEKKAKKAEVAK-SQKASGKGNAPKPG--KGPKLGGGGGKR---------------------------
RIC10191|RPL24B      LKAIPLITKIRHERHKKHITERQKQGKTKQRERDAKELEQDIQMLPKKDTMLSTQKTKVVVKVSQQQTEENLMEE-------------------------
RIC10192|RPL24B      LKAISLITKIRHERQKKHITERQKQGKTKQRERDAKELEQDIQMLP-KKVTLSTQKTKVVVKVSQQQTEENLMEE-------------------------
GMA10294|LOC10049997 IQKKRAE-KPEVRDAAREAALREIKERIKKTKDEKKAKKAEVTAKSQKAGGKG-ISKGAMPKGPKLGGGGGKR---------------------------
GMA10296|LOC10049972 IQKKRAE-KPEVRDAAREAALREIKERIKKTKDEKKAKKAEVASKSQKAGGKGNVSKGAMPKGPKLGGGGGKR---------------------------
GMA10297|LOC10049988 IQKKRTE-KPEVRDAAREAQLREIKERIKKTKDDKKAKKAEVAAKSQKSQGKGSISKGAMPKGPKLGGGGGKR---------------------------
GMA10298|LOC10079176 IQKKRAE-KPEVRDANREAALREIKERNKKTKDEKKAKKAEFAK-SQKSQGKGNVSKGAMPKGPKLGGGGGKR---------------------------
POP10058|RPL24       IQKKRAE-KPEVRDAAREAALREIKERIKKTKDEKKAKKAEVMSKAQKS-SKGSLPKGAAPKGPKLGGGGGKR---------------------------
CRE10057|RPL24       IQKKRAE-KPEVRQASREAAIREVKERAKKQKAERAAAAKAAAGPQKAAPKVVGRGKR------------------------------------------
VOL10062|RPL24       IQKKRTE-KPEVRQASREAAIREVKERMKKQKAERAAAAKAAAGPQKAAPKVVGRGKR------------------------------------------
HEM10068|rpl24       LHFYKKLTKIKYNRKFDFKIQKQKNKRS------------------------------------------------------------------------
PTR10059|RPL24       IKKKTAQ-KSELRTAARESALKELKDRKVANKAKTGSKVAKKATQSQTFQKVPKHMGGKGKRGGTQR---------------------------------
TPS10058|Rpl24       IKKKASQ-KAEFRSAQRDAALKEVKDRKKANKAKSSGKGAGQSVRAPKVPKNVKRR--------------------------------------------
CYA10058|RPL24       LRAKRQAPRAQVKTAARAAALKEIKARQQGSGGAGSGNSSGAGAKPKK----------------------------------------------------
DIC10057|RPL24       IQQKRAQ-KPEVKQAAAEQAKREIKEKKKAAAKKAAPKK-------------------------------------------------------------
PLA10065|RPL24       IRNRKAY-VQSIEAKNKAKFGTKEKEDKKKTKDDKKKNLVHFQQKKDFTKSKMLNMAKSKMHKMMKK---------------------------------
TGO10057|RPL24       IKRTRAQ-KPERQRAKSATAVKDAKEKSKKSKAAGVRPQSGPAQKVQIPKQQKQATRGRK----------------------------------------
GIA10057|Rpl24       VHVIDRVTEIQYARTKRHINSRKREHALKMLAT--KSAQKHGFSATMDFNSVDPLQMAAVEKVRMKKKIKERPYRPILRQKEIEARERLKAVVDSEVKQP
HAL10050|VNG1159G    ----------------------------------------------------------------------------------------------------
MET10049|MJ1201      ----------------------------------------------------------------------------------------------------
PYR10050|PH1495a     ----------------------------------------------------------------------------------------------------
SUL10058|STS039      ----------------------------------------------------------------------------------------------------


HUM10058|RPL24       --
DOG10057|Rpl24       --
MUS10057|Rpl24       --
RAT10057|Rpl24       --
CHK10059|Rpl24       --
FUG10058|RPL24       --
DAN10057|Rpl24       --
MED10057|Rpl24       --
CIO10057|RPL24       --
DRO10078|RpL24       --
MOS10058|Rpl24       --
BEE10059|Rpl24       --
CEL10061|rpl-24.1    --
BMA10057|RPL24       --
STE10057|RPL24       --
MBR10057|RPL24       --
NEU10058|Rpl24       --
GRI10057|Rpl24       --
GRA10058|Rpl24       --
STA10057|Rpl24       --
YAR10058|Rpl24       --
POM10100|RPL24       --
POM10101|RPL24-2     --
POM10102|RPL24-3     MD
YST10102|RPL24A      --
YST10103|RPL24B      --
CIN10058|Rpl24       --
NEA10057|Rpl24       --
MAY10057|Rpl24       --
RHI10220|Rpl24       --
RHI10221|Rpl24-2     --
RHI10222|Rpl24-3     --
RHI10223|Rpl24-4     --
ARA10160|RPL24A      --
ARA10161|RPL24B      --
RIC10188|RPL24A      --
RIC10189|RPL24A      --
RIC10190|RPL24A      --
RIC10191|RPL24B      --
RIC10192|RPL24B      --
GMA10294|LOC10049997 --
GMA10296|LOC10049972 --
GMA10297|LOC10049988 --
GMA10298|LOC10079176 --
POP10058|RPL24       --
CRE10057|RPL24       --
VOL10062|RPL24       --
HEM10068|rpl24       --
PTR10059|RPL24       --
TPS10058|Rpl24       --
CYA10058|RPL24       --
DIC10057|RPL24       --
PLA10065|RPL24       --
TGO10057|RPL24       --
GIA10057|Rpl24       V-
HAL10050|VNG1159G    --
MET10049|MJ1201      --
PYR10050|PH1495a     --
SUL10058|STS039      --