CLUSTAL W (2.1) Multiple Sequence Alignments
HAL10030|VNG1702G    ------MSEQPHKQRTRTKRASLHEKQDQVRATLSEELREEYGQRNVRVNVGDTVEVMRGD--DAGEDGEVTDVDLRDAEVFVEGVTVEAADGEETP---
MET10050|MJ0467      --MAFTKSKQPRKQRKALFNAPLHLRRKVMSAMLSKELKEKLGKNAIPVRKGDVVRIMRGD--FKGLEGEVIKVDLKRYRIYVEGANNKRQDGREVP---
PYR10031|PH1767      VRIMKMNSKQPRKQRKFLYNAPLHVRQKMMSAPLSKELREKYKVRNLPVRVGDKVRIMRGD--FKGYEGKVVEVDLKRYRIYVEGVTLRKVNGTEVF---
THE10042|TTHA1681    ------------------------------------------MRVKMHVKKGDTVLVASGK--YKGRVGKVKEVLPKKYAVIVEGVNIVKKAVRVSPKYP
SYN10044|sll1807     ----------------------------------MTKTKPAPHRVKMHVKKGDTIQVISGK--DKGKVGEVLRTIPSHSQVVVKGVNIRTKHVKPRQEGE
BAC10043|Bsu0127     ----------------------------------------------MHVKKGDKVMVISGK--DKGKQGTILAAFPKKDRVLVEGVNMVKKHSKPTQANP
ECO10043|rplX        --------------------------------------------MAAKIRRDDEVIVLTGK--DKGKRGKVKNVLSS-GKVIVEGINLVKKHQKPVPALN
SUL10033|STS060      ---------------------------------------------------------MRGDKDVLNFEGKVVEVNRKTGRIAIEGLTRKKADGTPVY---


HAL10030|VNG1702G    ---------RPVESSNLRVTDLDLDDDMRVERLEGDNE-----------------
MET10050|MJ0467      ---------YPIHPSNVMIIKLYDKDEKRFKHIKNE-------------------
PYR10031|PH1767      ---------YPIHPSNVMIIELNLDDEKRKKIIERRAG-----------------
THE10042|TTHA1681    Q-GGFIEKEAPLHASKVRPICPACGKPTRVRKKFLENGKKIRVCAKCGGALDTEE
SYN10044|sll1807     S-GQISSYEAPIHSSKVMLYSTKEKIASRICYTVTDDGRKVRMLKKTGEIID---
BAC10043|Bsu0127     Q-GGISNQEAPIHVSNVMPLDPKTGEVTRVGYKVED-GKKVRVAKKSGQVLDK--
ECO10043|rplX        QPGGIVEKEAAIQVSNVAIFNAATGKADRVGFRFED-GKKVRFFKSNSETIK---
SUL10033|STS060      ---------RWIHASKVIITKLDLSDAKRKEIIERKRKAREEYLKKKEQTTEAK-