CLUSTAL W (2.1) Multiple Sequence Alignments
HUM10060|RPL27       -MGKFMKPGKVVLVLAGRYSGRKAVIVKNIDDGTSD--RPYSHALVAGIDRYPRKVTAAMGKKKIAKRSK-IKSFVKVYNYNHLMPTRYSVDIPLDKT--
DOG10059|Rpl27       -MGKFMKPGKVVLVLAGRYSGRKAVIVKNIDDGTSD--RPYSHALVAGIDRYPRKVTAAMGKKKIAKRSK-IKSFVKVYNYNHLMPTRYSVDIPLDKT--
MUS10059|Rpl27       -MGKFMKPGKVVLVLAGRYSGRKAVIVKNIDDGTSD--RPYSHALVAGIDRYPRKVTAAMGKKKIAKRSK-IKSFVKVYNYNHLMPTRYSVDIPLDKT--
RAT10059|Rpl27       -MGKFMKPGKVVLVLAGRYSGRKAVIVKNIDDGTSD--RPYSHALVAGIDRYPRKVTAAMGKKKIAKRSK-IKSFVKVYNYNHLMPTRYSVDIPLDKT--
CHK10061|Rpl27       -MGKFMKPGKVVLVLAGRYSGRKAVIVKNIDDGTSD--RPYSHALVAGIDRYPRKVTAAMGKKKIAKRSK-IKSFVKVYNYNHLMPTRYSVDIPLDKT--
FUG10060|RPL27       -MGKFMKPGKVVMVLAGRYAGRKAVIVKNIDDGTAD--RPYSHALVAGIDRYPRKVTTTMGKKKIAKRSK-IKAFVKVFNYNHLMPTRYSVDIPLDKT--
DAN10059|Rpl27       -MGKFMKPGKVVMVLAGRYAGRKAVIVKNIDDGTAD--RPYSHALVAGIDRYPRKVTATMGKKKIAKRSK-IKAFVKVFNYNHLMPTRYSVDIPLDKT--
MED10059|Rpl27       -MGKFMKPGKVVMVLAGRYAGRKAVIVKNIDDGTAD--RPYSHALVAGIDRYPRKVTTTMGKKKIAKRSK-IKAFVKVFNYNHLMPTRYSVDIPLDKT--
CIO10059|RPL27       -MGKFMKPNKVVLILAGRYAGRKGIIVKNQDEGTND--RPYGHALVAGIDRYPRKVTKRMSKKKIKKRNK-IKTFVKVVNYNHLMPTRYSVDVPIDKS--
DRO10080|RpL27       -MRKIMKQGKIVIVLSGRYAGRKAIIVKTHDDGTPE--KPFGHALVAGIDRYPRKVTKKMGKNKLKKKSK-VKPFLKSLNYNHLMPTRYTAHDISFE---
MOS10060|Rpl27       -MGKIMKSGKVVLVLGGRYAGRKAIIMKTFDDGTSD--KQFGQALVAGIDRYPRRVTRNMSKDRIHKRCK-IKPFIKMLNYNHLMPTRYSVPDVNLDS--
BEE10061|Rpl27       -MVKIMKTGKVVLVLSGRYAGRKAIIMRNYDDGTTE--KQYGHAMVAGIDRYPRKVHKRMGKAKIHKRSK-IKPFVKVLNYNHLMPTRYT-VDLHWD---
CEL10064|rpl-27      -MGKIMKPGKVVLVLRGKYAGRKAVVVKQQDEGVSD--RTYPHAIIAGIDRYPLKVTKDMGKKKIEKRNK-LKPFLKVVSYTHLLPTRYSVDVAFDKT--
BMA10059|RPL27       -MGKIMKPGKVVLVLGGRFAGRKAIIVKAYDEGSSD--RAYSHALIAGIDKYPLMVTKRMGKKKIKSRSK-LRPFVGIASYSNLLPTRYSVDVLLDKN--
STE10059|RPL27       -MGKFIKSGKVVLVLRGRYAGKKALIIKNYDDGSSD--KPYGHALVAGVARYPLKVTKRMGKKRTAKRSK-VKPFVKVFNYNHLMPTRYSVDVPLDKQ--
MBR10059|RPL27       -MGRFLKEKKVVILLSGRYAGRKAVIVTPFDEGSG---KPFGHALVAGIDRYPRKITKRMSEKKIAKKST-VKPFLKVVNYNHIMPTRYSVSIDLDKA--
NEU10060|Rpl27       --MKFLKTSRVCLVTRGRYAGKKVVIIQPVDNGSKT--HPYGHAIVAGIERYPSKITRRMSKTRQEKRSK-VKPFIKVINYNHLMPTRYTLELEG-----
GRI10059|Rpl27       --MKFLKVGRVAIITRGRFAGKKVVIIQPVDSGNKL--HPYGHAIVAGIERYPLKITRRMSKTRQEKRNK-IKPFVKVVNYNHLMPTRYTLELEG-----
GRA10060|Rpl27       --MKFLKVGRVAIITRGRYAGKKVVIIQPVDNGNKP--HPFGHALVAGIERYPSKITRRMSKTRQEKRNK-IKPFIKVINYNHLMPTRYTLELEG-----
STA10059|Rpl27       --MKFLKVGRVVIITRGRYAGKKCVIISPLDNGTKS--HPFPHALVAGIERYPSKVTRRMSKNKQAKKSK-VKPFVKQVNYTHLMPTRYTIELDN-----
YAR10060|Rpl27       MSNKFLKSGKVALVVRGRYAGKKVVIIKAHDEGTKA--HPFPHALVAGVERYPLQVSADMDAKKIAKRTK-VKPFIKVVNYNHMMPTRYTLDLGSN----
POM10106|RPL27-1     -MVKILKPGKVALITRGRFAGKKVVILQAIDQGSKS--HPFGHAVVAGVERYPLKVTKSMGAKRIARRSR-VKPFIKVVNYNHLMPTRYALELDN-----
POM10107|RPL27-2     -MVKILKPGKVALVTRGRFAGKKVVILQNVDQGSKS--HPFGHAVVAGVERYPLKVTKSMGAKRIAKRSR-VKPFIKVINYNHLMPTRYALELDN-----
YST10106|RPL27A      -MAKFLKAGKVAVVVRGRYAGKKVVIVKPHDEGSKS--HPFGHALVAGIERYPLKVTKKHGAKKVAKRTK-IKPFIKVVNYNHLLPTRYTLDVEA-----
YST10107|RPL27B      -MAKFLKAGKVAVVVRGRYAGKKVVIVKPHDEGSKS--HPFGHALVAGIERYPSKVTKKHGAKKVAKRTK-IKPFIKVVNYNHLLPTRYTLDVEA-----
CIN10060|RPL27       -MVKVYKPGKVAIVLQGRQAGKKVVVIKQLDEGTKE--RPYPHAIVAGIERYPRKVTRRMGQKKVQRRSK-VKPFIKVVNYSHLFPTRYALELEG-----
NEA10059|Rpl27       -MVKIYKPGKVAVVLSGRQAGKKVVVIKQQDDGTKE--RPYPHAVVAGIERYPLKVTKNMGKKRIARRSK-VKPFIKVVNYAHLLPTRYMLELES-----
MAY10059|Rpl27       -MPKIYKPGKVAVVLSGRHAGKKVVVIKQFDDGSKD--KSFPYIIAAGIERYPQKVTKRMGAKKIAKRSK-VKPFVKVISYNHLMPTRYALELEG-----
RHI10228|Rpl27       -MVKFIKAGKVVVILQGRYAGKKAVVVRNHDEGTKE--RPYGYAVVAGIERTPLKVTKSMGKKKVAKRSK-VKPFIKIVNYNHMMPTRYALELEQ-----
RHI10229|Rpl27-2     -MVKFIKAGKVVVILQGRYAGKKAVVVRNHDEGTKE--RPYGYAVVAGVERTPLKVTKSMGKKKVAKRSK-VKPFIKIVNYNHMMPTRYGLELEQ-----
RHI10230|Rpl27-3     -MVKFIKAGKVVVVLQGRYAGKKAVVVRNHDEGTKD--RPYGYAVVAGIERSPLKVTKSMGKKKVAKRSK-VKPFVKIVNYNHMMPTRYALELEQ-----
RHI10231|Rpl27-4     -MVKFIKAGKVVVILQGRYAGKKAVVVRNHDEGTKD--RPYGYAVVAGIERTPLKVTKSMGKKKVAKRSK-VKPFVKIINYNHMMPTRYALELEQ-----
RHI10232|Rpl27-5     -MVKFIKAGKVVVILQGRYAGKKAVVVRNHDEGTKE--RPYGYAVVAGIERTPLKVTKSMGKKKVAKRSK-VKPFIKIVNYNHMMPTRYALELEQ-----
ARA10164|RPL27A      -MVKCMKPGKAVILLQGRYTGKKAVIVKSFDDGTV--EKKYGHCLVAGLKKYPSKVIRKDSAKKTAKKSR-VKCFFKVINYQHVMPTRYTLD--------
ARA10165|RPL27B      -MVKFLKQNKAVILLQGRYAGKKAVIIKSFDDGTS--DRRYGHCLVAGLKKYPSKVIRKDSAKKTAKKSR-VKCFIKLVNYQHLMPTRYTLD--------
ARA10166|RPL27C      -MVKFLKQNKAVILLQGRYAGKKAVIIKSFDDGNR--DRPYGHCLVAGLKKYPSKVIRKDSAKKTAKKSR-VKCFIKLVNYQHLMPTRYTLD--------
RIC10197|RPL27C      -MVKFLKPGKAVILLQGRFAGRKAVIVRVFEEGTR--DRPYGHCLVAGLAKYPKKVIRKDSAKKTAKKSR-VKCFLKLVNFTHLMPTRYTLD--------
RIC10198|RPL27B      -MVKFLKPGKAVILLQGRYAGRKAVIVRVFEEGTR--DRPYGHCLVAGLAKYPKKVIRKDSAKKTAKKSR-VKCFLKLVNFTHIMPTRYTLD--------
GMA10305|LOC10052724 -MVKFLKPNKAVIVLQGRYAGRKAVIVRTFDEGTR--ERPYGHCLVAGIKKYPSKVIKKDSAKKTAKKSR-VKAFVKLVNYQHLMPTRYTLD--------
GMA10306|LOC10079948 -MVKFLKPNKAVIVLQGRYAGKKAVIVRTFDEGTR--ERPYGHCLVAGIKKYPAKVIKKDSAKKTAKKSR-VKAFVKLVNYQHLMPTRYTLD--------
GMA10307|LOC10081794 -MVKFLKPNKAVIVLQGRYAGRKAVIVRTFDEGTR--ERPYGHCLVAGIKKYPSKVIKKDSAKKTAKKSR-VKAFVKLVNYQHLMPTRYTFD--------
GMA10308|LOC10079398 -MVKFLKPNKAVIVLQGRYAGKKAVIVRTFDEGTR--ERPYGHCLVAGIKKYPAKVIKKDSAKKTAKKSR-VKAFVKLVNYQHLMPTRYTLD--------
POP10060|RPL27       -MVKFLKTNKAVIILQGKYAGRKGVIVRSFDDGTR--DRPYGHCLVAGIKKYPSKVIKKDSAKKTAKKSR-VKCFIKLVNYQHLMPTRYTLD--------
CRE10059|RPL27       -MVKFLKPGKVVILLSGRYAGKKAVIVANKDDGSS--VRPYGHATVVGLAKEPRKVIKKISQKKQARRSS-IKTFVKTVNYQHIMPTRYTLD--------
VOL10065|RPL27       -MVKFLKPGKVVILLSGRYAGKKAVIVQNKDDGSS--LRPYGHAVVVGLSKEPRKVIRKISQKKQARRSS-IKTFIKTVNYQHMMPTRYTLD--------
HEM10055|rpl27       -MKTCFKNGRVVLILRGRFAGSKAIILTKSSDFDQN---SVQTFILAGIQKYPQLVTRKMSLKKISKKSR-MKIFIKKINMNHVFPTRFFIDLNKTTDKL
PTR10061|RPL27       --MAIIKAGKVVIVLAGRHAGKKAVVVKTFDDGTS--DKKFSHILIAGLARNPRMVTKGMSKAKVEKRSKQLKPFVKYINVRHVFPTRYVVD--MDLKK-
TPS10060|Rpl27       --MAIVKSGKVVIILAGRHAGKKAVVIKNIEDGND--DKQFSHCLVAGIARGPRKVTRGMSKKKVEKRSRTMKPFVKYVNVRHVFPTRYQVD--MDLKK-
CYA10060|RPL27       -MVKFIKPGKAVIVTSGRQAGHKAIIVRCYDEGGS--TRKFNHALVVGVERYPLRVTREMSEKRIAKRCR-IRPFVKFVNYVHMLPTRYNVDFYDELRQV
DIC10059|RPL27       MSSKFIKPGRLVILLNGKYAGRKAVVIKTFDDATASKSRPYGHCLVAGIDKYPRSIVRSMSRKTILKRTA-IRSFVKVVNYNHIMPTRYNFEGRDES---
PLA10068|RPL27       -MGKLLKPGKVIIILNGRRAGKKAVIVNTYEGQTR--ERPYSYCLVAGIEKHPLKVNKSMTKKKIVKRSK-VKAFIKCINVNHILPTRYQVANDFDIKS-
TGO10059|RPL27       -MVKLLKSGRVVVVLNGRHAGKKGVVVNTWEGSK---ERQFAFCLVAGIEKAPLKVHKKMPAKKIEKRMR-VKPFLKYINVNHLMPTRYTVSSDMDVKT-
GIA10059|Rpl27       MSQPIIKPGLVCIVLQGRHAGKKAVIVEALPHNERG-----SYAIVAGIAALPRRITNSMSDEEAVCRGR-VRSFVKCMNVNHLMPTSCRLENNYKD---


HUM10060|RPL27       -------------VVNKDVFRDPALKRKARREAKVKFEERYKTGKNK----------WFFQKLRF--
DOG10059|Rpl27       -------------VVNKDVFRDPALKRKARREAKVKFEERYKTGKNK----------WFFQKLRF--
MUS10059|Rpl27       -------------VVNKDVFRDPALKRKARREAKVKFEERYKTGKNK----------WFFQKLRF--
RAT10059|Rpl27       -------------VVNKDVFRDPALKRKARREAKVKFEERYKTGKNK----------WFFQKLRF--
CHK10061|Rpl27       -------------VVNKDVFRDPALKRKARREAKVKFEERYKTGKNK----------WFFQKLRF--
FUG10060|RPL27       -------------VVNKDVFRDPALKHKARREAKVKFEERYKTGKNK----------WFFQKLRF--
DAN10059|Rpl27       -------------VVNKDVFRDPALKRKARREAKVKFEERYKTGKNK----------WFFQKLRF--
MED10059|Rpl27       -------------VVNKDVFRDPALKRKARREAKVKFEERYKTGKNK----------WFFQKLRF--
CIO10059|RPL27       -------------SVNKEAIRDATGRRKARREIKSQFENRYKTGKNK----------WFFQKLRF--
DRO10080|RpL27       -------------KLSPKDLKDPVKRKTHRFQTRVKFESVYKEGKNK----------WFFQKLRF--
MOS10060|Rpl27       -------------KYSVADMKDPAKRKKARNQIRCKFEERHKTGKNK----------WFFQKLRF--
BEE10061|Rpl27       -------------KVTPKDLKDPMKRKKIRFQTRVKFEEKYKSGKNK----------WFFQKLRF--
CEL10064|rpl-27      -------------NINKEALKAPSKKRKALVEVKSKFEERYKTGKNK----------WFFTKLRF--
BMA10059|RPL27       -------------LINKDVLKEPGKKRRARMEVKKKFEERYKTGKNR----------WFFTKLRF--
STE10059|RPL27       -------------VVNKDVFRDPALKKKALREVKSTLEERYKSGKNK----------WFFQKLRF--
MBR10059|RPL27       -------------KVSKAALKDLSAKSKARKEIKSKFTKQYKAGEDK----------WFFQKLRF--
NEU10060|Rpl27       ----------LKGSVSAETFKEVSQREDAKKTVKKVLEERYTSGKNR----------WFFTPLRF--
GRI10059|Rpl27       ----------LKGSVTNDTFKEVSQREDAKKNVKKVLEERYTSGKNR----------WFFTPLS---
GRA10060|Rpl27       ----------LKGAVSNDTFKEVSQREDAKKTVKKVLEERYTSGKNR----------WFFTPLKF--
STA10059|Rpl27       ----------LKGVLAADTFKEVSQREEAKKTVKKAFEERYQSGKNR----------WFFTPLQF--
YAR10060|Rpl27       ----------LKNVIGTETFAEPTLREDAKKTIKQAFEERHKSGKNK----------WFFTKLRF--
POM10106|RPL27-1     ----------LKGLITADTFKEPTQRSAARKTVKKTFEEKYQSGKSA----------WFFTPLRF--
POM10107|RPL27-2     ----------LKGLVTPTTFSEPSQRSAAKKTVKNTFEEKYQTGKSA----------WFFTPLRF--
YST10106|RPL27A      ----------FKSVVSTETFEQPSQREEAKKVVKKAFEERHQAGKNQ----------WFFSKLRF--
YST10107|RPL27B      ----------FKSVVSTETFEQPSQREEAKKVVKKAFEERHQAGKNQ----------WFFSKLRF--
CIN10060|RPL27       ----------LKGSVTNDTFKEPSQREDAKKNIKKLLEERYQSGKNR----------WFFQALRF--
NEA10059|Rpl27       ----------LKGSVSSETFKEPTQREDSKKAIKKAFEERYQKGQNR----------WFFSKLRF--
MAY10059|Rpl27       ----------LKGAVTQDTFKEPSQREDAKKQIKQIFEEKYTSGKNK----------WFFTPLRF--
RHI10228|Rpl27       ----------IKGTISSETFKEPTQREDSKKVIKKLFEERYQTGKNK----------WFFSKLRF--
RHI10229|Rpl27-2     ----------IKGTISSETFKEPTQREDSKKVIKKLFEERYQTGKNK----------WFFSKLRF--
RHI10230|Rpl27-3     ----------IKGTISSETFKEPTQREDAKKIIKKLFEERYQTGKNK----------WFFSKLRF--
RHI10231|Rpl27-4     ----------IKGTISSETFKEPTQREDSKKVIKKLFEERYQTGKNK----------WFFSKLRF--
RHI10232|Rpl27-5     ----------IKGTISSETFKEPTQREDSKKVIKKLFEERYQTGKNK----------WFFSKLRF--
ARA10164|RPL27A      L------DLKNVVSA--DAISSKDKKVTALKEAKAKFEERFKTGKNR----------WFFTKLRF--
ARA10165|RPL27B      V------DLKEVATL--DALKSKDKKVTALKEAKAKLEERFKTGKNR----------WFFTKLRF--
ARA10166|RPL27C      V------DLKEVATL--DALQSKDKKVAALKEAKAKLEERFKTGKNR----------WFFTKLRF--
RIC10197|RPL27C      V------DLKEVAAG-PDALATRDKKVAACKSAKARLEDRFKTGKNR----------WFFTKLRF--
RIC10198|RPL27B      V------DFKDVASGGPDALATRDKKVAACKAAKARLEERFKTGKNR----------WFFTKLRF--
GMA10305|LOC10052724 V------DLKDAVTP--DVLATKDKKVTALKETKKRLEERFKTGKNR----------WFFTKLRF--
GMA10306|LOC10079948 V------DLKDAVNP--DVLNAKDKKVTALKETKKRLEERFKTGKNR----------WFFTKLRF--
GMA10307|LOC10081794 V------DLKDAVTP--DVLGTKDKKVTALKETKKRLEERFKTGKNR----------WFFTKLRF--
GMA10308|LOC10079398 V------DLKDAVTP--DVLQAKDKKVTALKETKKRLEERFKTGKNR----------WFFTKLRF--
POP10060|RPL27       V------DLKDVVTA--DCLSTKDKKITACKETKARFEERFKTGKNR----------WFFTKLRF--
CRE10059|RPL27       V------DLKAVVAP--EAIESAAKKTDARKECKKLLEEKFKSGKNR----------WFFSKLRF--
VOL10065|RPL27       V------DLKNVISA--EALETATKKTEARKEAKKLLEEKFKSGKNR----------WFFSKLRF--
HEM10055|rpl27       VNEKIEDFRDFIGKKIENKEIFSKEKQVFSSFLKNIFLDQFFSGKQK----------WFFKKLRF--
PTR10061|RPL27       -------------AVDEADLVDAERKVDVKKGLKKLFYDRYLNQKEVTSEKKSQGSSYFFQKLRF--
TPS10060|Rpl27       -------------AVDEADLLAADKKIEVKKALKKIFEDRYLNQKEVTSEKKAAGSSYFFQKLRF--
CYA10060|RPL27       L------PETLGLGTADDPWTTLESRRSCRIAVKKILEQKYLTGKYR----------WFFTKLRF--
DIC10059|RPL27       -------AFTGLKNTVTVESSQVAKRAHTRLAVKKIFEAKHKAGKSK----------WFFSKLRF--
PLA10068|RPL27       -------------LASDDVLKSKNKKKEVKK-LGKIFRDKFLEPVNKKTGEVSKDISFLHKKLYF--
TGO10059|RPL27       -------------MVPEDAMRTVDDRKAAKKGLKKIFYEKFTNPVNEKVGKVSKDLLFLRKKLRF--
GIA10059|Rpl27       -------------FISTQTVADVTKRREIIETVNKDFQRRILEHRDT----------WFFTKLPIDA