CLUSTAL W (2.1) Multiple Sequence Alignments
HUM10063|RPL29       MAKSKNHTTHNQSRKWHRNGIKKPRSQRYESLKGVDPKFLRNMRFAKKHNKKGLKKMQANNAKAMSARAEAIKALVKPKEVKPKIPKGVSRKLDRLAYIA
DOG10062|Rpl29       MAKSKNHTTHNQSRKWHRNGIKKPRSQRYESLKGVDPKFLRNMRFAKKHNKKGLKKMQANNAKAMAARAEAIKALVKPKEVKPKIPKGGSRKLNRLAYIA
MUS10062|Rpl29       MAKSKNHTTHNQSRKWHRNGIKKPRSQRYESLKGVDPKFLRNMRFAKKHNKKGLKKMQANNAKAVSARAEAIKALVKPQAIKPKMPKGP--KLKRLAFIA
RAT10062|Rpl29       MAKSKNHTTHNQSRKWHRNGIKKPRSQRYESLKGVDPKFLRNMRFAKKHNKKGLKKMQANNAKAVSARAEAIKALVKPQAVKPKMPKGSSRKLSRLAFIA
FUG10063|RPL29       MAKSKNHTSHNQSRKAHRNGIKRPKSNRYESLKGVDSKFLRNMRFAKKHNKKGQKAIRKAAAQAK-----------------------------------
DAN10062|Rpl29       MAKSKNHTTHNQSRKWHRNGIKKPRSQRYESLKGVDPKFLRNMRFAKKHNKKGAKTIARKEASK------------------------------------
MED10062|Rpl29       MAKSKNHTTHNQSRKAHRNGIKKPRSQRYESLKGVDPKFLRNMRFAKKHNKKGMKAARKAAQQK------------------------------------
CIO10062|RPL29       MAKSKNHTNHNQNRKYHKNGIKKPRTNKYPSLKGVDPKYLKNMKFAKKHNKRHPVKKE------------------------------------------
DRO10083|RpL29       MAKSKNHTNHNQNKKAHRNGIKRPLRKRHESTLGMDVKFLINQRYARKGNLSREESVKRYNERIASQKGKPKPVTL------------------------
MOS10063|Rpl29       MAKSKNHTNHNQNQKAHKNGIKKPKRKRNESKRGMCQKFLRNLRYSKKGNVSHEESLKRAEERKAKYAGQPAPVKL------------------------
BEE10064|Rpl29       MAKSKNHTNHNQNRKAHRNGIKKPKRYRHESTLGMDLKFLRNQRFAKKHNLKPKEQLKRAEKRKALREAKK-----------------------------
CEL10066|rpl-29      MAKSKNHTNHNQNKKAHRNGITKPKKHIFLSMKGVDAKFIKNLRFSRKNNKRQINKSVESKA--------------------------------------
BMA10062|RPL29       MAKSKNHTSHNQNRKDHRNGIKKPKKHRFMSMKGVDQKFLRNLRFAKKHNKRHQHQKKESKA--------------------------------------
STE10062|RPL29       MAKSKNHTNHNQGHKWHRNGIKKPRTNRYPSLKGVDPKFLRNLRFSKKHNKKHPNVAAK-----------------------------------------
MBR10062|RPL29       MAKSKNHTAHNQNYKAHRNGLKKPKTKRFPALKGMDPKFLRNMRFAKKGNVRAAQEQKA-----------------------------------------
NEU10063|Rpl29       MAKSKNSSQHNQSRKAHRNGIKKPKTSRYPSLKGTDPKFRRNHRHALHGTAKALKEFKEGKRETA-----------------------------------
GRI10062|Rpl29       MAKSKNSSQHNQSRKAHRNGIKKPKTSRYPSLKGTDPKFRRNHRHALHGTAKAIKEFKEGKRETA-----------------------------------
GRA10063|Rpl29       MAKSKNSSQHNQSRKAHRNGIKKPKTSRYPSLKGTDPKFRRNHRHALHGNMKALKEAKEGKREVV-----------------------------------
STA10062|Rpl29       MAKSKNSSQHNQSKKNHRNGIKKPKTHRYPSLKGTDPKFRRNHRHALHGTMKALKEVKEGKRDSA-----------------------------------
YAR10063|Rpl29       MAKSKNHTNHNQIKKAHRNGIKRVKTHKYRSLKGVDAKFRRNHRYALAGNAKALAERRAEKA--------------------------------------
POM10111|RPL29       MAKSKNHTNHNQNKKAHRNGIKRPQKHRYDSLKYRDAKFRRNQKFANRGTVEAIRQAKASA---------------------------------------
YST10109|RPL29       MAKSKNHTAHNQTRKAHRNGIKKPKTYKYPSLKGVDPKFRRNHKHALHGTAKALAAAKK-----------------------------------------
CIN10063|Rpl29       MAKSKNHTNHNQTRKAHRNGIKRPKSHRTPSMKGVDPKFRRNARFARVGSERARAEQKAAAAS-------------------------------------
NEA10062|Rpl29       MAKSKNHTAHNQNKKAHRNKIQRPKTNKYHSLKGVDPKFRRNARYAAQGSAKAIREAKASA---------------------------------------
MAY10062|Rpl29       MAKSKNSSQHNQVRKAHRNGIKKPKTNKYPSLRGVDPKFVRNQRYAKHGTEKALKAARAEA---------------------------------------
RHI10240|Rpl29       MAKSKNHTNHNQNKKAHRNGIKKAATHKYRSQKGLDAKFLRNQRFAKKGTQKALAAAVKK----------------------------------------
RHI10241|Rpl29-2     MAKSKNHTNHNQNKKAHRNGIKKAATHKYRSQKGLDAKFLRNQRFAKKGTQKALAAAVKK----------------------------------------
ARA10172|RPL29A      MAKSKNHTAHNQSAKAHKNGIKKPRRHRHTPTRGMDPKFLRNQRYARKHNVKAGENASAEE---------------------------------------
ARA10173|RPL29B      MAKSKNHTAHNQSAKAHKNGIKKPRRHRHTPTRGMDPKFLRNQRYARKHNVKSGENAGVEE---------------------------------------
RIC10207|RPL29A      MAKSKNHTAHNQSYKAHKNGIKKPKRHRQTSTKGMDPKFLRNQRYSRKHNKKSGEAESEE----------------------------------------
RIC10208|RPL29B      MAKSKNHTAHNQSYKAHKNGIKKPKRHRQTSTKGMDPKFLRNQRYSRKHNKKSGEAESEE----------------------------------------
GMA10320|LOC10080321 MAKSKNHTAHNQSYKAHKNGIKKPKRHRHTSTKGMDPKFLRNQRYARKHNKKSGETATEEE---------------------------------------
GMA10321|LOC10081010 MAKSKNHTAHNQSYKAHKNGIKKPKRHRHTSTKGMDPKFLRNQRYARKHNKKSGETATEEE---------------------------------------
GMA10322|LOC10077718 MAKSKNHTAHNQSYKAHKNGIKKPKRHRHTSTKGMDPKFLRNQRYARKHNKKSGETATEEE---------------------------------------
GMA10323|LOC10049987 MAKSKNHTAHNQSYKAHKNGIKKPKRHRHTSTKGMDPKFLRNQRYARKHNKKSGEIATEEE---------------------------------------
POP10063|RPL29       MAKSKNHTAHNQSHKAHKNGIKKPKRHRHTSTKGMDPKFLRNQRYARKHNKKCGDSATEEE---------------------------------------
CRE10062|RPL29       MAKSKNHTGHNQNRKCHRNGIKKPQKNKFPSRKGMDPKFLRNQRYAKRHNKKVELQRGSLE---------------------------------------
VOL10067|RPL29       MAKSKNHTAHNQNRKAHRNGIKKPQKHKYASRKGMDPKFLRNQRYAKKHNKKAE----------------------------------------------
PTR10064|RPL29       MVKQKNTCAHNSTHKAHANGIKKAKRSKFVSTKGMDPKFLRNQKFAKKYNGTKRRHDDE-----------------------------------------
TPS10063|Rpl29       MVKQKNTCAHNNTHKAHANGIKKKKRTKYVSTRGMDPKFLRNQKFCKKWNSSKRPQDE------------------------------------------
CYA10063|RPL29       MAKSKNHTNHNQSRKAHRNGIKRPRSHRYASTKGMYQKFLRNQRFARKGSVLALKLARRQARRAAEQKMETV----------------------------
DIC10062|RPL29       MAKSKNHSTHHKNRKDHRNGIKKAVVHKKTSSKGVELGFARNQRYARIGTEIKRYVRAAKKAAAKK----------------------------------
PLA10084|RPL29       MAKSKNHTNHNQNRKAHKNGIKKPKKHKFMSRKGLDPNFFRNQKYCLKGIQKKKKELKLKAKQEKNN---------------------------------
TGO10062|RPL29       MAKSKNHTNHNQNKKAHRNGIKKPQRKRKMSTKGMCPKFLRNQRACKRGMMKSD----------------------------------------------
GIA10062|Rpl29       MAKLKNHTSKNQNRKDHRNGIKKPKKSAYTSHKGMCPKYLRNLRRSRANDPRQSLRPNLNKE--------------------------------------


HUM10063|RPL29       HPKLGKRARARIAKGLRLCRPKAKAKAKDQTKAQAAAPASVPAQAPKRTQAPTKASE---------------
DOG10062|Rpl29       HPKLGKRARARIAKGLRLCRPKAKAKAQTKAQAAAATPAPAPAPAPAPAPAPASTPAAQAPKGAQAPTKAPV
MUS10062|Rpl29       HPKLGKRIRSYMAKGQRLCQPKPKVQTKAGAKAPAKAQASAPAQAPKGAQAPKGAQAPVKAP----------
RAT10062|Rpl29       HPKLGKKIRSYMAKGRRLCQPKPKVQTKAEAKAPAKAQAKAPAQAPKGAQAPVKAP----------------
FUG10063|RPL29       ------------------------------------------------------------------------
DAN10062|Rpl29       ------------------------------------------------------------------------
MED10062|Rpl29       ------------------------------------------------------------------------
CIO10062|RPL29       ------------------------------------------------------------------------
DRO10083|RpL29       ------------------------------------------------------------------------
MOS10063|Rpl29       ------------------------------------------------------------------------
BEE10064|Rpl29       ------------------------------------------------------------------------
CEL10066|rpl-29      ------------------------------------------------------------------------
BMA10062|RPL29       ------------------------------------------------------------------------
STE10062|RPL29       ------------------------------------------------------------------------
MBR10062|RPL29       ------------------------------------------------------------------------
NEU10063|Rpl29       ------------------------------------------------------------------------
GRI10062|Rpl29       ------------------------------------------------------------------------
GRA10063|Rpl29       ------------------------------------------------------------------------
STA10062|Rpl29       ------------------------------------------------------------------------
YAR10063|Rpl29       ------------------------------------------------------------------------
POM10111|RPL29       ------------------------------------------------------------------------
YST10109|RPL29       ------------------------------------------------------------------------
CIN10063|Rpl29       ------------------------------------------------------------------------
NEA10062|Rpl29       ------------------------------------------------------------------------
MAY10062|Rpl29       ------------------------------------------------------------------------
RHI10240|Rpl29       ------------------------------------------------------------------------
RHI10241|Rpl29-2     ------------------------------------------------------------------------
ARA10172|RPL29A      ------------------------------------------------------------------------
ARA10173|RPL29B      ------------------------------------------------------------------------
RIC10207|RPL29A      ------------------------------------------------------------------------
RIC10208|RPL29B      ------------------------------------------------------------------------
GMA10320|LOC10080321 ------------------------------------------------------------------------
GMA10321|LOC10081010 ------------------------------------------------------------------------
GMA10322|LOC10077718 ------------------------------------------------------------------------
GMA10323|LOC10049987 ------------------------------------------------------------------------
POP10063|RPL29       ------------------------------------------------------------------------
CRE10062|RPL29       ------------------------------------------------------------------------
VOL10067|RPL29       ------------------------------------------------------------------------
PTR10064|RPL29       ------------------------------------------------------------------------
TPS10063|Rpl29       ------------------------------------------------------------------------
CYA10063|RPL29       ------------------------------------------------------------------------
DIC10062|RPL29       ------------------------------------------------------------------------
PLA10084|RPL29       ------------------------------------------------------------------------
TGO10062|RPL29       ------------------------------------------------------------------------
GIA10062|Rpl29       ------------------------------------------------------------------------