CLUSTAL W (2.1) Multiple Sequence Alignments
HAL10017|VNG1692G    ----------------MGRRIQGQRRGRGTSTFRAPSHRYKAELSHKRTEDTD--------------------VLAGEVIDVEHDPARSAPVARVAFEDD
MET10027|MJ0179      ----------------MGKRLISQRRGRGSSVYTCPSHKRRGEAKYRRFDELEKKG-----------------KVLGKIVDILHDPGRSAPVAKVEYETG
PYR10016|PH1775      ----------------MGKSLIQQRRGKGSPTFRSPSHRFRGAVKYIPLNYTQDK------------------TIRGVVEEIMHDPGRTAPVARVKFENG
THE10022|TTHA1689    MAVKKFKPYTPSRRFMTVADFSEITKTEPEKSLVKPLKKTGGRNNQGRITVRFRGGGHKRLYRIIDFKRWDKVGIPAKVAAIEYDPNRSARIALLHYVDG
SYN10024|sll1802     MGIRNYRPMTPGTRQASVSDFTEITKSKPEKSLTTNRHDQKGRNNRGVITSRHRGGGHKKLYRIIDFK-RNKQNIPARVAAIEYDPNRNARIALLFYTDG
BAC10023|Bsu0119     MAIKKYKPSSNGRRGMTTSDFAEITTDKPEKSLLAPLHKKGGRNNQGKLTVRHQGGGHKRQYRVIDFK-RDKDGIPGRVATVEYDPNRSANIALINYADG
ECO10023|rplB        MAVVKCKPTSPGRRHVVKVVNPELHKGKPFAPLLEKNSKSGGRNNNGRITTRHIGGGHKQAYRIVDFK-RNKDGIPAVVERLEYDPNRSANIALVLYKDG
SUL10017|ST0427      -------------VKIMGKKLLQQRAGRGGINFRSPSWRRVGKAKIPNIEGEHIG----------------------KVIDIVHNPGTNAPLALIKLDDG


HAL10017|VNG1692G    DQRLVLASEGVGVGDTIEIGISATIEEGNTLPLAEIPEGVPVCNVESHPGDGGKFARAGGVNADLVTHERDATIVELPSGETKRLSPDCRATIGVVAGGG
MET10027|MJ0179      EEGLLVVPEGVKVGDIIECGVSAEIKPGNILPLGAIPEGIPVFNIETVPGDGGKLVRAGGCYAHILTHDGERTYVKLPSGHIKALHSMCRATIGVVAGGG
PYR10016|PH1775      MEKLIIAPEGLLVGQEIYIGPDAPVEIGNTLPLAKIPEGTYIYNIEGVPGDGGKYVRAGGTYALVVSREKDKVIVQLPSGELKAFDPNCRATIGVVAGGG
THE10022|TTHA1689    EKRYIIAPDGLQVGQQVVAGPDAPIQVGNALPLRFIPVGTVVHAVELEPKKGAKLARAAGTSAQIQGREGDYVILRLPSGELRKVHGECYATVGAVGNAD
SYN10024|sll1802     EKRYILAPAGLQVGMTVIAGEEAPFEIGNTLPLSRIPLGSEIHNVELVAGRGGQMVRSAGAFAQVVAKEGDYVTIKLPSKEVRMVRKECVATLGRVSNAE
BAC10023|Bsu0119     EKRYILAPKGIQVGTEIMSGPEADIKVGNALPLINIPVGTVVHNIELKPGKGGQLVRSAGTSAQVLGKEGKYVLVRLNSGEVRMILSACRASIGQVGNEQ
ECO10023|rplB        ERRYILAPKGLKAGDQIQSGVDAAIKPGNTLPMRNIPVGSTVHNVEMKPGKGGQLARSAGTYVQIVARDGAYVTLRLRSGEMRKVEADCRATLGEVGNAE
SUL10017|ST0427      TKFYVPSVQGLVVGQKIQIGKNAAISNGNIVEVGNVPEGTIISNIEKTRGDGGKFARSAGTYGVVVGKTGDKVLVKLSSEKIAQVSSNARAIVGVVAGGG


HAL10017|VNG1692G    RTEKPFVKAGNKHHKMKARGTKWPRVRGVAMNAVDHPFGGGGRQHP----------GRPKSVSRDAAP-GRKVGDIASKRTGRGGNE
MET10027|MJ0179      RKEKPFVKAGKKYHAMKAKAVKWPRVRGVAMNAVDHPFGGGRHQHT----------GKPTTVSRKKVPPGRKVGHISARRTGVRK--
PYR10016|PH1775      RLEKPLVKAGKAYYKYKARNKFWPTPRGVKMNAVNHPFGG-KEHHP----------GKPTTTSRRAPP-GRKVGHIAARRTGRRK--
THE10022|TTHA1689    HKNIVLGKAGRSRWLGRR-----PHVRGAAMNPVDHPHGGGEGRAPRGRP-PASPWGWQTKGLKTRKRRKPSSRFIIARRKK-----
SYN10024|sll1802     FRNLKLGKAGRKRHLGRR-----PHVRGSVMNPCDHPHGGGEGRAPIGRSGPVSPWGKPALGAKTRNKKKRSSALIVRRRTK-----
BAC10023|Bsu0119     HELINIGKAGRSRWKGIR-----PTVRGSVMNPNDHPHGGGEGRAPIGRKSPMSPWGKPTLEFKTRKQKNKSDKFIVRRRKNK----
ECO10023|rplB        HMLRVLGKAGAARWRGVR-----PTVRGTAMNPVDHPHGGGEGRN--FGKHPVTPWGVQTKGKKTRSNK-RTDKFIVRRRSK-----
SUL10017|ST0427      VTEKPLLKAGNNYWKYKVKAKKWPHVRGVAMNAVSHPHGGGLHQSV----------SRPSTVSRNAPP-GRKVGHIAARRTGRKEGA