CLUSTAL W (2.1) Multiple Sequence Alignments
HUM10034|RPL3        MSHRKFSAPRHGSLGFLPRKRSSRHRGKVKSFPKD-DPSKPVHLTAFLGYKAGMTHIVREVDRPGSKVNKKEVVEAVTIVETPPMVVVGIVGYVETPRGL
DOG10033|Rpl3        MSHRKFSAPRHGSLGFLPRKRSSRHRGKVKSFPKD-DSSKPVHLTAFLGYKAGMTHIVREVDRPGSKVNKKEVVEAVTIVETPPMVVVGIVGYVETPRGL
MUS10033|Rpl3        MSHRKFSAPRHGSLGFLPRKRSSRHRGKVKSFPKD-DASKPVHLTAFLGYKAGMTHIVREVDRPGSKVNKKEVVEAVTIVETPPMVVVGIVGYVETPRGL
RAT10033|Rpl3        MSHRKFSAPRHGSLGFLPRKRSSRHRGKVKSFPKD-DPSKPVHLTAFLGYKAGMTHIVREVDRPGSKVNKKEVVEAVTIVETPPMVVVGIVGYVETPRGL
CHK10034|Rpl3        MSHRKFSAPRHGSLGFLPRKRSSRHRGKVKSFPKD-DPSKPVHLTAFLGYKAGMTHIVREVDRPGSKVNKKEVVEAVTIVETPPMVIVGIVGYVQTPRGL
FUG10034|RPL3        MSHRKFSAPRHGSLGFLPRKRSRRHRGKAKSFPKD-DPSKPVHMTAFLGYKAGMTHIVREVDRPGSKVNKKEVVEAVTIVETPPMVVIGVVGYVNTPSGL
DAN10033|Rpl3        MSHRKFSAPRHGSLGFLPRKRCKRHRGKVKSFPKD-DPSKPVHLTAFLGYKAGMTHIVREVDRPGSKVNKKEVVEAVTVVETPPMIVVGVVGYVMTPRGL
MED10033|Rpl3        MSHRKFSAPRHGSLGFLPRKRSSRHRGKCKSFPKD-DPSKPVHLTAFLGYKAGMTHIVREVDRPGSKVNKKEVVEAVTIVETPPMVVVGVTGYVSTPRGL
CIO10033|RPL3        MSHRKFSAPRHGSLGFLPRKRSSRHRGKVKAFPRD-DPSKPCHLTAFISYKAGMTHVVREVDRPGSKVNKKEVVDAVTILEAPPMIVVGVIGYIETPRGL
DRO10042|RpL3        MSHRKFSAPRHGSMAFYPKKRSARHRGKVKAFPKD-DASKPVHLTCFIGYKAGMTHIVREADRPGSKINKKEVVEAVTVLETPPMIVVGAVGYIETPFGL
MOS10033|Rpl3        MSHRKFSAPRHGSMAFYPKKRASRHQGRVKAFPKD-DASKPVHLTAFLAYKAGMTHIVREADRPGSKINKKEVVEAVTILETPPLVVVGAVGYIETPFGP
BEE10034|Rpl3        MSHRKFSAPRHGSMGFYPKKRSQRHRGKVKAFPKD-DPSKPVHLTAFIGYKAGMTHVVREADRPGSKVNKKEIVEAVTILETPPMIVVGVVGYIETPHGL
CEL10033|rpl-3       MSHRKFSAPRHGHMGFTPKKRSRTYRGRIKAFPKD-DKSKPIHLTAFLGYKAGMTHIVRDVDKPGSKVNKKEVVEAVTIVETPPMVIAGVTGYVDTPQGP
BMA10033|RPL3        MSHRKFSAPRHGSMGFTPKKRSKRHRGKVKAFPKD-DPSKPIHLTAFMGFKAGMTHIVREVDKPGSKVNKKEVVEAVTVLETPPMIIVGVVGYIDTPRGP
STE10033|RPL3        MSHRKFEAPRHGSLGFLPRKRCKRHRGKVKSFPKD-DNTLPPHLTAFIGFKAGMTHILREVEKPGSKLNKKEKVEAVTIIETPPMMVVGVVGYIETPRGM
MBR10033|RPL3        MSHRKFRAPRHGHLGFLPKKRCKHHRGQIRSFPKE-QKGDKPHLTAFLGYKAGMTHIVRDLDRTGSLAHKKEVVEAVTVVETPPIVVVGVVGYTSTPRGL
NEU10034|Rpl3        MSHRKYEAPRHGSLAYLPRKRAARHRGKVKSFPKD-DAKKPVHLTAAMGYKAGMTTIVRDLDRPGAKAHKKEVVEAVTIIDTPPMIVVGLVGYIETPRGL
GRI10033|Rpl3        MSHRKYEAPRHGSLAYLPRKRAARHRGKVKSFPKD-DPKKPVHLTAAMGYKAGMTTIVRDLDRPGAKAHKKEVVEAVSIIDTPPMIVVGLVGYIETPRGL
GRA10034|Rpl3        MSHRKFEAPRHGSLAYLPRKRAARHRGKVKSFPKD-DPKKPVHLTAAMGYKAGMTTIVRDLDRPGAKANKKEIVEAVTIVDTPPMIVVGLVGYIETPRGL
YAR10034|Rpl3        MSHRKYEQPRHGHLGFLPRKRCTKSRGKAKSFPKD-DKSKPVALTAFLGYKAGMTTIVRDLDRRGSKMDKREIVEAATVVDTPPMVVVGVVGYVATPRGL
POM10056|RPL3-1      MSHCKFEQPRHGSLGFLPRKRASRQRGKVKAFPKD-DASKPVHLTAFLGYKAGMTHIVRDLDRPGSKMHKREILEAVTVIETPPMVVVGVVGYVETPRGL
POM10057|RPL3-2      MSHCKFEQPRHGSLGFLPRKRASRQRGKVKAFPKD-DASKPVHLTAFLGYKAGMTHIVRDLDRPGSKMHKREILEAVTIIETPPMVVVGVVGYVETPRGL
YST10057|RPL3        MSHRKYEAPRHGHLGFLPRKRAASIRARVKAFPKD-DRSKPVALTSFLGYKAGMTTIVRDLDRPGSKFHKREVVEAVTVVDTPPVVVVGVVGYVETPRGL
CIN10033|Rpl3        MSHRKYEAPRHGSLGFLPRKRAARHRGKVKAFPKD-DPKKPVHLTAMMGYKAGMTHVVRDLDRPGSKFHKREVVEAVTIIETPPMIAVGLVGYVETPRGL
NEA10033|Rpl3        MSHRKYEEPRHGSLAFLPRKRAARHRGRCKAFPKD-DPKKPVHLTAVMGYKAGMTHIVRDLDRPGSKMHKREVVEAVTVIETPPMVVVGAVGYVETPRGL
MAY10033|Rpl3        MSHCKFEHPRHGSLGFLPRKRAARHRGKVKAFPKD-DPKKPVHLTAMIGYKAGMTHIVRDLDRPGSKMHKKEIVEAVTVIETPPMVAVGVVGYVETPRGL
RHI10125|Rpl3        MSHRKYEAPRHGHLGFGPRKRTRSHRGRVKAYPKD-DAKKPVHLTAFMGYKAGMTHIVRDLERPGSKMHKKEIVEAVTVIEAPAMVIVGVVGYVETPRGL
RHI10126|Rpl3-2      MSHRKYEAPRHGHLGFGPRKRTRSHRGRVKAYPKD-DAKKPVHLTAFMGYKAGMTHIVRDLERPGSKMHKKEIVEAVTVIEAPAMVVVGVVGYVETPRGL
RHI10127|Rpl3-3      MSHRKYEAPRHGHLGFGPRKRTRSHRGRVKAYPKD-DAKKPVHLTAFMGYKAGMTHIVRDLERPGSKMHKKEIVEAVTVIEAPAMVVVGVVGYVETPRGL
RHI10128|Rpl3-4      MSHRKYEAPRHGHLGFGPRKRTRSHRGRVKAYPKD-DAKKPVHLTAFMGYKAGMTHIVRDLERPGSKMHKKEIVEAVTVIEVPAMVVVGVVGYVETPRGL
ARA10093|RPL3A       MSHRKFEHPRHGSLGFLPRKRANRHRGKVKAFPKD-DQTKPCKFTAFMGYKAGMTHIVREVEKPGSKLHKKETCEAVTIIETPAMVVVGVVAYVKTPRGL
ARA10094|RPL3B       MSHRKFEHPRHGSLGFLPRKRASRHRGKVKAFPKD-DPTKPCRLTSFLGYKAGMTHIVRDVEKPGSKLHKKETCEAVTIIETPPMVVVGVVGYVKTPRGL
RIC10106|RPL3B       MSHRKFEHPRHGSLGFLPRKRSSRHRGKVKSFPKD-DVSKPCHLTSFVGYKAGMTHIVREVEKPGSKLHKKETCEAVTIIETPPLVIVGLVAYVKTPRGL
RIC10107|RPL3A       MSHRKFEHPRHGSLGFLPRKRSSRHRGKVKSFPKD-DVNKPCHLTSFVGYKAGMTHIVREVEKPGSKLHKKETCEAVTIIETPPIVVVGLVAYVKTPRGL
GMA10166|LOC10081913 MSHRKFEHPRHGSLGFLPRKRAARHRGKVKAFPKD-DPSKAPKLTAFLGYKAGMTHIVREVEKPGSKLHKKETCEPVTIIETPPMVIVGVVGYVKTPRGL
GMA10167|LOC10080625 MSHRKFEHPRHGSLGFLPRKRAARHRGKVKAFPKD-DPSKAPKLTAFLGYKAGMTHIVREVEKPGSKLHKKETCEPVTIIETPPMVIVGVVGYVKTPRGL
GMA10168|LOC10079217 MSHRKFEHPRHGSLGFLPRKRASRHRGKVKAFPKD-NPSQPCRLTAFVGYKAGMTHIVREVEKPGSKLHKKETCEAVTIIETPPLVVVGVVGYVKTPRGL
GMA10169|LOC10078290 MSHRKFEHPRHGSLGFLPRKRASRHRGKVKAFPKD-NPSQPCGLTAFVGYKAGMTHIVREVEKPGSKLHKKETCEAVTIIETPPLVVVGVVGYVKTPRGL
POP10033|RPL3        MSHRKFEHPRHGSLGFLPRKRAARHRGKVKSFPKD-DPTKPCKLTSFLGYKAGMTHIVREVEKPGSKLHKKETCEAVTIVETPPMVIVGVVGYLKTPSGL
CRE10033|RPL3        MSHRKFEHPRSGSLGFSPRKRCRRGKGKVKSFPRD-DASKPVHLTAFMGYKAGMTHIVRDVEKPGSKLHKKETCEPVTIIECPPMVVVGAVGYVKTPRGL
VOL10036|RPL3        MSHRKFEHPRSGSLGFSPRKRCRRGRGKVKSFPRD-DASKPVHLTAFMGYKAGMTHIVREVEKPGSKLHKKETCEPVTIIECPPMVVVGVVGYVKTPRGL
HEM10030|rpl3        MSHRKYEAPRHGSLGFLPKKRCRRGKGKIKSFPKD-NENHPCHLTASIGFKAGMTHVVRTVDKFGSKLHGKDVVEAVTVIETPPLQIVGFVGYIKTPKGL
PTR10035|RPL3        MSHRKFEAPRHGSLGFLPKKRTKYHSGRIRSFPRD-DAAEQPHLTAFRGYKAGMTHVVRGVDRPGALMHKREVVDAVSIVETPPMVVVGVVGYVETPSGL
TPS10033|Rpl3        MSHRKFEAPRHGNLGFLPKKRTKHHSGRIRSFPKDNDASAPPHLTAFRAYKAGMTHVVRGVDRPGAVMHKREVVDAVSILETPPMVVVGVVGYLETPRGL
CYA10034|RPL3        MSHRKYEAPRHGSLGFLPRGRTKRHRGRVRSWPRDPGPAVPPHLTAFPVVKAGCTHVVRQIDRPGSKVHKKEVAEPVTILEAPPIVICGIVGYSETPRGL
DIC10033|RPL3        MSHRKFEAPRHGNLGFRPRKRAARHQGKVKSFPKD-DRTQKVHLTAFMGYKAGMTHVVRDLEKPGSKMHKKEIVEAVTIIECPPMYIVGLVGYVETAQGL
PLA10037|RPL3        MSHRKFERPRHGSLGFLPRKRCKRLRGKIRSFPKD-DKEKPPHFTAFMGYKAGMTHIVREVDKPGSKLHKKEIVEACTIIECAPMVVVGIVGYRETPKGL
TGO10033|RPL3        MSHRKFERPRHGSLGFLPRKRCKRHRGKVKAFPKD-DPSKPPHLTAFMGYKAGMTHVVRELDKPGSKLHKKEIVEAVTVVDTPPMVCVGVVGYIETPRGL
GIA10033|Rpl3        MSHRKFSCCRKGNLGYLPRKRCTRGRGRCKTFPPD-VQGAPIHLTAFLGYKAGCTHVMRFIDHRGSNLHNRQAIDQATIIDAPPMICTAIIGYAKTPKGL


HUM10034|RPL3        RTFKTVFAEH-ISDECKRRFYKNWHKSK-KKAFTKYCKKWQDEDGKKQLEKD--FSSMKKYCQVIRVIAHTQMRLLP-LRQKKAHLMEIQVNGG-TVAEK
DOG10033|Rpl3        RTFKTIFAEH-ISDECKRRFYKNWHKSK-KKAFTKYCKKWQDDDGKKQLEKD--FNSMKKYCQVIRVIAHTQMRLLP-LRQKKAHLMEIQVNGG-TVAEK
MUS10033|Rpl3        RTFKTVFAEH-ISDECKRRFYKNWHKSK-KKAFTKYCKKWQDDTGKKQLEKD--FNSMKKYCQVIRIIAHTQMRLLP-LRQKKAHLMEIQVNGG-TVAEK
RAT10033|Rpl3        RTFKTVFAEH-ISDECKRRFYKNWHKSK-KKAFTKYCKKWQDDTGKKQLEKD--FNSMKKYCQVIRIIAHTQMRLLP-LRQKKAHLMEIQVNGG-TVAEK
CHK10034|Rpl3        RSFKTIFAEH-ISDECKRRFYKNWHKSK-KKAFTKYCKKWQDEEGKKQLEKD--FNSMKKYCQVIRVMAHTQMRLLP-LRQKKSHLMEIQVNGG-TVAEK
FUG10034|RPL3        RSFKTIFAEH-ISDECKRRFYKNWYKSK-KKAFTKYCKKWQDDEGKKQLEKD--FNLMKKYCQVIRVITHTQMRLLP-IRQKKSHLMEVQLNGG-TISDK
DAN10033|Rpl3        RSFKTIFAEH-ISDECKRRFYKNWYKSK-KKAFTKYCKRWQDEEGKKQLEKD--FSSMKKYCQIIRIIAHTQMRLLP-HRQKKSHLMEIQLNGG-TISDK
MED10033|Rpl3        RSFKTIFAEH-ISDECKRRFYKNWYKSK-KKAFTKYCKKWQDEEGKKQLEKD--FASMKKYCQVIRVIAHTQMRLLP-LKQKKSHLMEVQLNGG-TISDK
CIO10033|RPL3        RTLKTLFAEH-LSDECKRRFYKNWYACK-KKAFTKSCRKWQDEEGKRQIDRD--FNQMKKYCKVIRVIAHTQMKLLP-ITQKKSHIMEIQVNGG-TIPEK
DRO10042|RpL3        RALVNVWAQH-LSEECRRRFYKNWYKSK-KKAFTKASKKWTDDLGKKSIEND--FRKMLRYCKVIRVIAHSQIRLIK-QRQKKAHVMEIQLNGG-SIEDK
MOS10033|Rpl3        RALCNVWAQH-LSEECRRRFYKNWHASK-KKAFTKASKKWTDDLGKKSIEDT--FKKMVRYCKFIRVIAHSQIRLIK-QGQKKAHIIEIQLNGG-SIADK
BEE10034|Rpl3        RALTTVWAEH-LSEDCRRRFYKNWYKSK-KKAFTKASKKWQDDLGRKSIEND--FKKIIKYCKVVRIIAHTQMKLLR-QRQKKAHIMEIQLNGG-TIEQK
CEL10033|rpl-3       RALTTIWAEH-LSEEARRRFYSNWAKSK-KKAFTKYAKKWQDEDGKKLIEAD--FAKLKKYCSSIRVIAHTQMKILR-RRQKKAHLVEIQVNGG-TIEQK
BMA10033|RPL3        RQFKTVWAEH-LSEDCRRRFYKNWNSSK-KKAFQKHAKKWQDEDGMKSIQAD--LAKMKKYCSIIRVIAHTQMKVMK-HREKKAHIMEIQVNGG-TVPEK
STE10033|RPL3        RVLKTIWAEH-LSEECKRRFYKNWCNSK-KKAFTKASKRWADDDGKKSIEED--FNTMKKYCKVIRVICHTQQKLLK-MRQKKAHIMEIQVNGGKDVAEK
MBR10033|RPL3        RQLTTVWATH-MAEGFIRRCYKHFAASK-KAAFRKYFSKRNTPEGQQQFDDD--LARMVKYCSVIRVIVHTQMKKLN-LGQKKAHVMEIQINGG-SIQEK
NEU10034|Rpl3        RSLTTVWAEH-LSDEVKRRFYKNWYKSK-KKAFTKYVKKHSDNN-GAAITRE--LERIKKYCTVVRVLAHTQIRKTP-LKQKKAHLMEIQINGG-SVADK
GRI10033|Rpl3        RSLTTVWAEH-LSDEVKRRFYKNWYKSK-KKAFTKYAKKHSESK-ASSVTRE--LERIKKYCTVVRVLAHTQIRKTP-LKQKKAHLMEIQVNGG-SVADK
GRA10034|Rpl3        RSLTTVWAEH-LSDEIKRRFYKNWYKSK-KKAFTKYAKKHSENN-GASITRE--LERIKKYCTVVRVLAHTQIRKTP-LKQKKAHLMEIQVNGG-SIADK
YAR10034|Rpl3        RSLTTVWAEH-LSEEVRRRFYKNWYKSK-KTAFTKYAKQYEGD--AAQVQKE--LERIKKYCTVVRVLAHTQPKLTP-LKQKKAHLAEIQINGG-SVADK
POM10056|RPL3-1      RSLTTVWAEH-LSEEVKRRFYKNWFKSK-KKAFTKYAKKYAES--TQSINRE--LERIKKYCSVVRVLAHTQIRKTP-LAQKKAHLMEIQVNGG-SVADK
POM10057|RPL3-2      RSLTTVWAEH-LSEEVKRRFYKNWFKSK-KKAFTKYAKKYAES--TQSINRE--LERIKKYCSVVRVLAHTQIRKTP-LAQKKAHLMEIQVNGG-SVADK
YST10057|RPL3        RSLTTVWAEH-LSDEVKRRFYKNWYKSK-KKAFTKYSAKYAQD--GAGIERE--LARIKKYASVVRVLVHTQIRKTP-LAQKKAHLAEIQLNGG-SISEK
CIN10033|Rpl3        RTLTTVWANH-LSDEVKRRFYKNWYRSK-KKAFTRYAKKNAEDG-GKSVQRE--LERIRKYCSVVRVLAHTQIRKTG-LAQKKAHLMEIQINGG-SVADK
NEA10033|Rpl3        RSLTTVWAEH-LSDEVKRRFYKNWYRSK-KKAFTRYAKKHSENS-GASVARE--FERIKKYCTVVRVLAHTQISKTG-LQQKKAHLMEIQVNGG-SVADK
MAY10033|Rpl3        RSLTTVWAEH-LSDEVKRRFYKNWYRSK-KKAFTRYAKKHSENN-GASISRE--LERIKKYCTVVRVLAHTQVRKTG-LKQKKAHLMEVQINGG-SVAEK
RHI10125|Rpl3        RSLTTVWAEH-LSEEAKRRFYKNWYRSK-KKAFTKYAQKYAEG--AKDVTRE--LERIKKYCSVVRVIAHTQISKAK-LHQRKAHIMEIQLNGG-SVEQK
RHI10126|Rpl3-2      RSLTTVWAEH-LSEEAKRRFYKNWYRSK-KKAFTKYAQKYAEG--AKDVTRE--LERIKKYCSVVRVIAHTQISKAK-LHQRKAHIMEIQLNGG-SVEQK
RHI10127|Rpl3-3      RSLTTVWAEH-LSEEAKRRFYKNWYRSK-KKAFTKYAQKYAEG--AKDVTRE--LERIKKYCSVVRVIAHTQISKAK-LHQRKAHIMEIQLNGG-SVEQK
RHI10128|Rpl3-4      RSLTTVWAEH-LSEEAKRRFYKNWYRSK-KKAFTKYAQKYAEG--AKDVTRE--LERIKKYCSVVRVIAHTQISKAK-LHQRKAHIMEIQLNGG-SVEQK
ARA10093|RPL3A       RSLNTVWAQH-LSEEVRRRFYKNWAKSK-KKAFTGYAKQYDSEDGKKGIQAQ--LEKMKKYATVIRVLAHTQIRKMKGLKQKKAHMMEIQINGG-TIAQK
ARA10094|RPL3B       RSLCTVWAQH-LSEELRRRFYKNWAKSK-KKAFTRYSKKHETEEGKKDIQSQ--LEKMKKYCSVIRVLAHTQIRKMKGLKQKKAHLNEIQINGG-DIAKK
RIC10106|RPL3B       RSLNSVWAQH-LSEEVRRRFYKNWCKSK-KKAFTKYALKYDSDAGKKEIQMQ--LEKMKKYASIVRVIAHTQIRKMKGLKQKKAHLMEIQINGG-TIADK
RIC10107|RPL3A       RSLNSVWAQH-LSEEVRRRFYKNWCKSK-KKAFTKYALKYDSDAGKKEIQMQ--LEKMKKYASVVRVIVHTQIRKMKGLKQKKAHLMEIQINGG-TIADK
GMA10166|LOC10081913 RTLNTVWAQH-LSEELKRRFYKNWCKSK-KKAFTKYSKQYETEEGKKNIEAQ--LEKLKKYATVVRVLAHTQIRKMKGLKQKKAHIMEIQVNGG-TIAQK
GMA10167|LOC10080625 RTLNTVWAQH-LSEELKRRFYKNWCKSK-KKAFTKYSKQYETEEGKKNIEAQ--LEKLKKYATVVRVLAHTQIRKMKGLKQKKAHIMEIQVNGG-SIAQK
GMA10168|LOC10079217 RTLNTIWAQH-LSEEVKRRFYKNWCKSK-KKAFTKYSKKYETEEGKKDIESQ--LEKLKKYATVIRVLAHTQIRKLKGLKQKKAHLMEIQVNGG-TVDQK
GMA10169|LOC10078290 RTLNTVWAQH-LSEEVKRRFYKNWCKSK-KKAFTKYSKKYETEEGKKDIESQ--LEKLKKYATVIRVLAHTQIRKLKGLKQKKAHLMEIQVNGG-TVDQK
POP10033|RPL3        RTLNTVWAQH-LSEEVKRRFYKNWCKSK-KKAFAKYSKQYETDEGKKSIQSQ--LEKLKKYATVIRVLAHTQIRKMKGLKQKKAHLMEIQVNGG-TIAQK
CRE10033|RPL3        RSLNTVWAEH-LSEEVKRRFYKNWYKSK-KKAFTKYAKKYS--DGKKAIEAE--LAALKKHCCVIRVLAHTQVKKLG-FGVKKAHLMEVQVNGG-TVAQK
VOL10036|RPL3        RSLNTVWAEH-LSEEVKRRFYKNWFKSK-KKAFTKYAKKYS--DGKKAIEAE--LASLKKHCSVIRVLAHTQVKKLG-FGQKKAHLIEIQVNGG-TVAQK
HEM10030|rpl3        RSFRTVWSTNNFPEEFKRNFYKNWYKSK-RKAFKKKQKTELEYNGFSVFENQKIKFQIKKFCPIIRCIAFSKISKTG-LKQKKAPVLEIQINGG-NTTQK
PTR10035|RPL3        RTLTTVFTEH-LSEEFKRRCYKNWYNSK-KKAYTKYALKYQ-KDGGKDIENE--LERIKKFCSVVRVIAHSQVKKLN-LRIKKAHIMEIQVNG-GDTAAK
TPS10033|Rpl3        RTLTTVFAEH-LSEEFKRRAYKNWYKSK-RKAYTKYAKKYT-ENDGKDIEKE--LERIAKHCKVVRVITHSQVKKLH-LRIRKAHIMEVQINGGADAKAK
CYA10034|RPL3        RAIRTVFAEH-LNDEVKRRFYKNWYRAK-KKAFTKYALAKY-SMG--EYRND--LDTIRRHCSVVRVIAHTQQRKFR-LRQKKAHILEIQING-GTIPEK
DIC10033|RPL3        KTYKTVWAQH-LSDNFRRRLYKNWYKSKSKKAFTKYVKQYETEEGKKSIEAS--LQAIKKRCSVVRVIAHTQVHKLK-LTQKKAHVLEIQVNGG-SIVEK
PLA10037|RPL3        RILSTVWANH-VSDEFRRRYYKNWYKSE----KKAFTKSLN--VPEATKNCL--LKRIEKYCTVLRAICHTQPSKTP-LRMKKAHIMEVQINGG-SMKEK
TGO10033|RPL3        RALVTVWAGH-LSDECKRRFYKNWYKSK----RKAFTKYAKRYGDNNKMEAE--LTRMKNYCSVIRAICHTQPSKTP-IGSKKAHVMEIQVNGG-SIAEK
GIA10033|Rpl3        RAVTTVWAAH-IAEPAMRRFYRNYFHAE-KTAFSTYMKKAADGTYIKEQLGR-----LKQHADVIRIVAHTQPALTP-LKQKKADIMEIQVNGGANVAEK


HUM10034|RPL3        LDWARERLEQQVPVNQVFGQDEMIDVIGVTKGKGYKGVTSRWHTKKLPRKTHRGLRKVACIGAWHPARVAFSVARAGQKGYHHRTEINKKIYKIGQGYLI
DOG10033|Rpl3        LDWARERLEQQVPVNQVFGQDEMIDVIGVTKGKGYKGVTSRWHTKKLPRKTHRGLRKVACIGAWHPARVAFSVARAGQKGYHHRTEINKKIYKIGQGYLI
MUS10033|Rpl3        LDWARERLEQQVPVNQVFGQDEMIDVIGVTKGKGYKGVTSRWHTKKLPRKTHRGLRKVACIGAWHPARVAFSVARAGQKGYHHRTEINKKIYKIGQGYLI
RAT10033|Rpl3        LDWARERLEQQVPVNQVFGQDEMIDVIGVTKGKGYKGVTSRWHTKKLPRKTHRGLRKVACIGAWHPARVAFSVARAGQKGYHHRTEINKKIYKIGQGYLI
CHK10034|Rpl3        VDWAREKLEQQVPVSSVFGQDEMIDVIGVTKGKGYKGVTSRWHTKKLPRKTHRGLRKVACIGAWHPARVAFSVARAGQKGYHHRTEINKKIYKIGQGYQI
FUG10034|RPL3        VDWAREKLEQSIPINTVFTQDEMIDVIGITKGHGYKGVTSRWHTKKLPRKTHRGLRKVACIGAWHPARVAFSVARAGQKGYHHRTEINKKIYKIGQGFHT
DAN10033|Rpl3        VDWAREKLEQSIPIANVFSQDEMIDVIGVTKGHGCKGVTSRWHTKKLPRKTHRGLRKVACIGAWHPARVAFSVARAGQKGYHHRTEINKKIYKIGVGYHN
MED10033|Rpl3        VDWAREKLEQAVPVNTVFTQDEMIDVIGVTKGHGYKGVTSRWHTKKLPRKTHRGLRKVACIGAWHPARVAFSVARAGQKGYHHRTEINKKIYKIGQGYHT
CIO10033|RPL3        VDYARDLLEKPVPVSNIFAKDEMIDIIGVNKGHGEKGVTSRWHTKKLPRKTHKGLRKVACIGAWHPARVAYSVARSGQKGYHHRTEVNKKIYRLGAGIHK
DRO10042|RpL3        VKWAREHLEKPIQVSNVFGQDEMIDCVGVTKGKGFKGVTSRWHTKKLPRKTHKGLRKVACIGAWHPSRVSTTVARAGQKGYHHRTEINKKIYRIGAGIHT
MOS10033|Rpl3        VNWVKEHLEKPIPVSQVFSQDEMIDCVAVTKGKGFKGVTSRWHTKKLPRKTHKGLRKVACIGAWHPSRVAFTVARAGQKGYHHRTELNKKIYRLGAGIHT
BEE10034|Rpl3        VQWAREHLEKPVPVSNVFAPDEMIDVIGVTKGKGYKGVTSRWHTKKLPRKTHKGLRKVACIGAWHPSRVSFTVARAGQKGYHHRTEMNKKIYRIGQGIHT
CEL10033|rpl-3       VDWAREHLEKQVQVDTVFAQDEMIDTIGVTRGHGFKGVTSRWHTKKLPRKTHKGLRKVACIGAWHPSRVAFTVARAGQKGFHHRTIINNKIYRIGKSALT
BMA10033|RPL3        VDWAYEHFEKQVPVDSVFAQDEMIDTIGVTKGKGFKGVTSRWHTKKLPRKTHKGLRKVACIGAWHPSRVQFTVARAGQKGYHHRTEVNKKIYRIAKSCLT
STE10033|RPL3        VDWCRERLENPAPVRKVFSPDEMIDVIGVTKGHGFKGVTYRWGTKKLPRKKHKGLRKVGCIGAWDPDRVSFSVARAGQAGYHHRTELNKKIYRIGQGIHK
MBR10033|RPL3        VDFAKSLLEKEVPIKDVFSQNEHIDIIGVTKGHGFEGVTHRWGTKKLPRKTHKGLRKVACIGAWHPANVTYAVPRAGQRGYHHRTEMNKKIYRIGAGYHE
NEU10034|Rpl3        VEFGHGLFEKPVSIDSIFEKDEVIDVIAVTKGHGFTGVTARWGTKKLPRKTHKGLRKVACIGAWHPSHVQWTVARAGQAGYHHRTSVNHKIYRIGKGDA-
GRI10033|Rpl3        VEFGHGLFEKPVSIDTIFEQNEMIDIIAVTKGHGFNGVTSRWGTKKLPRKTHKGLRKVACIGAWHPSHVQWTVARAGQMGYHHRTSVNHKVYRIGKGDA-
GRA10034|Rpl3        VSFGQELFEKPVDVSSIFEQDEMIDVVAVTKGHGFNGVTARWGTKKLPRKTHKGLRKVACIGAWHPSHVQWTVARAGQMGYHHRTSVNHKIYRIGKGDA-
YAR10034|Rpl3        VEWAQQHFEKTVTIDTVFEQDEMIDAIAITKGKGYEGTTHRWGTKKLPRKTHRGLRKVACIGAWHPANVQYTVARSGQDGYHHRTSANHKVYRVGKGGD-
POM10056|RPL3-1      VEWAREHFEKTVDIKSTFEQNEMIDVIGVTRGKGNEGTTARWGTKRLPRKTHRGLRKVACIGAWHPANVQWTVARAGNAGYMHRTQLNSKIYRIGAGDD-
POM10057|RPL3-2      VEWAREHFEKTVDIKSTFEQNEMIDVIGVTRGKGNEGTTARWGTKRLPRKTHRGLRKVACIGAWHPANVQWTVARAGNAGYMHRTQLNSKIYRIGAGDD-
YST10057|RPL3        VDWAREHFEKTVAVDSVFEQNEMIDAIAVTKGHGFEGVTHRWGTKKLPRKTHRGLRKVACIGAWHPAHVMWSVARAGQRGYHSRTSINHKIYRVGKGDD-
CIN10033|Rpl3        VDFGYKLFEKPIEVSSVFEQDENVDVIAVTKGHGFEGVTHRWGTKKLPRKTHKGLRKVACIGAWHPSNVMFSVARAGQNGYHHRTEINKKIYRIGLGSD-
NEA10033|Rpl3        VDFARSHFEKTVDVGSVFEQDECIDIIGVSKGHGYEGVTARWGTTRLPRKTHRGLRKVACIGAWHPSNVMFSVARAGQRGYHSRTSMNHKIYRIANGAS-
MAY10033|Rpl3        VDFAKEHFEKTFDVKSVFEQNEIIDVIAVTKGHGYEGVTARWGTKKLPRKTHRGLRKIACIGAWHPANVMFTVARSGQDGYHHRTEIGKKIYRISNGED-
RHI10125|Rpl3        VDFAREHFEKEVTVGSIFEQDEMIDIIATTKGHGFEGVTHRWGTKKLPRKTHRGLRKVACIGAWHPSRVMYSVARAGQRGYHRRTEINKKIYRIATGAD-
RHI10126|Rpl3-2      VDWAREHFEKEVTVGSIFEQDEMIDIIATTKGHGFEGVTHRWGTKKLPRKTHRGLRKVACIGAWHPSRVMYSVARAGQRGYHRRTEINKKIYRIATGAD-
RHI10127|Rpl3-3      VDWAREHFEKEVTVGSIFEQDEMIDIIATTKGHGFEGVTHRWGTKKLPRKTHRGLRKVACIGAWHPSRVMYSVARAGQRGYHRRTEINKKIYRIATGAD-
RHI10128|Rpl3-4      VDWAREHFEKEVTVGSIFEQDEMIDIIATTKGHGFEGVTHRWGTKKLPRKTHRGLRKVACIGAWHPSRVMYSVARAGQRGYHRRTEINKKIYRIATGAD-
ARA10093|RPL3A       VDFAYSFFEKQIPIEAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTRLPRKTHRGLRKVACIGAWHPARVSYTVARAGQNGYHHRTELNKKIYRLGKV---
ARA10094|RPL3B       VDYACSLFEKQVPVDAIFQKDEMIDIIGVTKGKGYEGVVTRWGVTRLPRKTHRGLRKVACIGAWHPARVSYTVARAGQNGYHHRTEMNKKVYRVGKV---
RIC10106|RPL3B       VDYGYKFFEKEIPVDAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTRLPRKTHRGLRKVACIGAWHPARVSYTVARAGQNGYHHRTEMNKKVYKIGKS---
RIC10107|RPL3A       VDYGYKFFEKEIPVDAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTRLPRKTHRGLRKVACIGAWHPARVSYTVARAGQNGYHHRTEMNKKVYKIGKS---
GMA10166|LOC10081913 VDFAYSFFEKQVPIDAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTRLPRKTHRGLRKVACIGAWHPARVSFTVARAGQNGYHHRTELNKKVYKLGKA---
GMA10167|LOC10080625 VDFAYSFFEKQVPIDAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTRLPRKTHRGLRKVACIGAWHPARVSFTVARAGQNGYHHRTELNKKVYKLGKA---
GMA10168|LOC10079217 VDYAYSFFEKQIPVDAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTRLPRKTHRGLRKVACIGAWHPARVSFTVARAGQNGYHHRTELNKKIYKVAKA---
GMA10169|LOC10078290 VDYAYSFFEKQIPVDAVFHKDEMIDIVGVTKGKGYEGVVTRWGVTRLPRKTHRGLRKVACIGAWHPARVSFTVARAGQNGYHHRTELNKKIYKVAKA---
POP10033|RPL3        VDFAYGFFEKQVPIDAVFQKDEMIDVIGVTKGKGYEGVVTRWGVTRLPRKTHRGLRKVACIGAWHPARVSFTVARAGQNGYHHRTELNKKIYKVGKV---
CRE10033|RPL3        VDFAYSMFEKQVSVDAVFQPNEMIDTIAITKGHGVQGVVQRWGVTRLPRKTHRGLRKVACIGAWHPARVKWTVARAGQQGFHHRTEINKKVYKIGKK---
VOL10036|RPL3        VDFAYAMFEKQVSVDAVFQPNEMIDTIAITKGHGVQGVVQRWGVTRLPRKTHRGLRKVACIGAWHPARVKWTVARAGQQGFHHRTEINKKVYKIGKK---
HEM10030|rpl3        INFVEKISQKEISISDIFRQREIIDTIGITKGKGFQGVIKRWGVTKLPRKTHRGARKVACVGSWHPSRVSFRVPRAGQTGFHHRTQINLQIYRVGKALD-
PTR10035|RPL3        VDFAKNLFEKEVTVDSIFAKDEQIDVLGVTRGHGYEGVTTRWGVSRLPRKTHRGLRKVACIGSWHPARVSTTVPRAGQNGYFHRTEMNKKVYRVGKKGD-
TPS10033|Rpl3        VDFAKSLFEKEVTVDSVFAKDELIDVLGVTKGHGYEGVTTRWGVSRLPRKTHRGLRKVACIGSWHPARVSDTVPRAGQNGYHHRTEMNKKIYRIGKKGD-
CYA10034|RPL3        VDFAERLLEKTVSIDDVISNDEMVDTIGVTRGKGFEGVVTRFGVRRLPRKTHRGLRKVACIGAWHPARVQFTVPRAGQRGYHHRTQMNLKVYRIGKKGD-
DIC10033|RPL3        VNFAVANFEKTVNVTGVFAENELIDVIGVTKGKGFNGVIKRWGVRKLPRKTHKGLRKVACIGAWHPSRVSTTVPRAGQLGYHHRVERNKKIYRIGQAQP-
PLA10037|RPL3        LEFVKEMLEKNLPVSTVFNPNEMIDVISVTKGHGTKGVVSRYGVKRLPRKTHRGLRKVACIGAWHPARVQFQIPRHGQKGYFHRTERNKKIYRIGLK---
TGO10033|RPL3        VDFCTKMFETAVPVKAVFTEGEMIDVIGVTKGHGVKGVVSRWGVTRLPRKTHRGLRKIACIGAWHPARVQFQVPRHGQKGYFHRTEMNKKVYRVGNG---
GIA10033|Rpl3        VDYAYALMEKPISIKDVFSVGAQIDTISITRGRGFEGVVTRWGVTRLPRKTRRGNRKVACIGAWHPANVQYTVARAGQMGYFHRTDTNKQVFMIDTAEN-


HUM10034|RPL3        KDGKLIKNNASTDYDLSDKSINPLGGFVHYGEVTNDFVMLKGCVVGTKKRVLTLRKSLLVQTKRRALEKIDLKFIDTTSKFGHGRFQTMEEKKAFMGPLK
DOG10033|Rpl3        KDGKLIKNNASTDYDLSDKSINPLGGFVHYGEVTNDFVMLKGCVVGTKKRVLTLRKSLLVQTKRRALEKIDLKFIDTTSKFGHGRFQTVEEKKAFMGPLK
MUS10033|Rpl3        KDGKLIKNNASTDYDLSDKSINPLGGFVHYGEVTNDFIMLKGCVVGTKKRVLTLRKSLLVQTKRRALEKIDLKFIDTTSKFGHGRFQTMEEKKAFMGPLK
RAT10033|Rpl3        KDGKLIKNNASTDYDLSDKSINPLGGFVHYGEVTNDFIMLKGCVVGTKKRVLTLRKSLLVQTKRRALEKIDLKFIDTTSKFGHGRFQTMEEKKAFMGPLK
CHK10034|Rpl3        KDGKLIKNNASTDYDLSDKSINPLGGFVHYGEVTNDFIMLKGCVVGTKKRVLTLRKSLLVQTKRRALEKIDLKFIDTTSKFGQGPFQTAKEKKSFMGPLK
FUG10034|RPL3        KDGKLVKSNASTDYDLSNKSINPLGGFVHYGEVTNDFVMLKGCVVGTKKRVLTLRKSLLVQTSRRALEKIDLKFIDTTSKFGHGRFQTMEEKKAFMGPLK
DAN10033|Rpl3        KDGKLVKNNASTDYDLSNKSINPLGGFVHYGEVTNDFLMLKGCVVGTKKRVLTLRKSLLVQTSRRAQEKIDLKFIDTTSKFGHGRFQTIEEKKNFMGPLK
MED10033|Rpl3        KDGKVVKNNASTEYDLSNKSINPLGGFVHYGQVANDFVMVKGCVVGTKKRVLTLRKSLLVQTSRRALEKIDLKFIDTTSKFGHGRFQTIEEKKAFMGPLK
CIO10033|RPL3        EGGKLIKNNAATETDITDKSITPMGGFPHYGEVKNDFVMIKGCCIGPKKRVLTLRKSLITHTKRAALEKINLKWIDTSSKFGHGRFQTHEEKRAFMGPLK
DRO10042|RpL3        KDGKVIKNNASTEYDLTDKSITPMGGFPHYGEVNNDFVMIKGCCIGSKKRIITLRKSLLKHTKRSALEQIKLKFIDTSSKMGHGRFQTPADKLAFMGPLK
MOS10033|Rpl3        KDGKVIKNSAATEYDLTDKSITPMGGFPFYGEINQDFLMIKGCCIGAKRRVITLRKSLLVHTKRSALEQIKLKFIDTSSKMGHGRFQTPADKRAYYGVLK
BEE10034|Rpl3        KDGKIVKNNASTEYDLTEKTITPMGGFPHYGEVNNDFIMIKGCCMGPKKRVITLRKSLLVHTKRSALEKINLKFIDTSSKFGHGRFQTAADKTSFMGQLK
CEL10033|rpl-3       EEG---KNNGSTEFDLTQKTITPMGGFPRYGIVNQDYIMLRGAVLGPKKRLITLRKSLITQTKRVAHEKINLKWIDTSSKTGHGRFQTTAEKRAFMGKLK
BMA10033|RPL3        EEG---RRNGGTDYDITEKSINPMGGFPHYGLVNQDFVLIRGCCMGSKKRPITLRKSLITQTKRFAYEKINLKWIDTSSKFGHGRFQTHAEKKAFMGKLK
STE10033|RPL3        KDGKVIKNNASTEYDLTDKSITPMGGFPHYGQVNEDFLMVKGCVVGPKKRVLTLRKSLLVHTSRDAAEKITLKFIDTSSKFGHGRFQHPAEKRAFMGMLK
MBR10033|RPL3        KDGKLVTANAVCEADPTEKSINPMGGFPHYGLVKEDFLIIKGCTVGTKKRVLTLRKSILPDTSRRAQEEVTLKFIDTSSKFGHGRFQTGEEKLGFMGKLK
NEU10034|Rpl3        ------EDSAATEVDVTKKKITPMGGFVRYGEINNDFVMVKGSVPGVKKRVMTLRKSMFVHTSRKALEKVELKWIDTSSEFGHGAFQTPAEKKQFQGTLK
GRI10033|Rpl3        ------EDNAATEIDVTKKKITPMGGFVRYGEINNDFVMVKGSIPGTKKRVMTLRKSMFIHTSRKALEKVELKWIDTSSEFGHGAFQTPEEKKTYQGTLK
GRA10034|Rpl3        ------DDNAATEIDVTKKTITPLGGFVRYGEVKNDFVMLKGSIPGVKKRVMTLRKTMFPQTSRRALEKVSLKWIDTSSEFGHGAFQTPAEKKQYQGTLK
YAR10034|Rpl3        ------ESNGSTEFDRTPKTITPMGGFVRYGEVNNDFLILKGSIPGVKKRVITLRKSMWLHTSRRDLEKTQLKWIDTASKFGKGRFQTPAEKTAFMGTLK
POM10056|RPL3-1      ------AKNASTDFDATEKRITPMGGFVRYGVVENDFVMLNGATPGPVKRVLTLRKSLLTHTSRKALEPVSLKWIDTASKFGHGRFQTPAEAKQFLGTLK
POM10057|RPL3-2      ------AKNASTDFDATEKRITPMGGFVRYGVVENDFVMLNGATPGPVKRVLTLRKSLLTHTSRKALEPVSLKWIDTASKFGHGRFQTPAEAKQFLGTLK
YST10057|RPL3        ------EANGATSFDRTKKTITPMGGFVHYGEIKNDFIMVKGCIPGNRKRIVTLRKSLYTNTSRKALEEVSLKWIDTASKFGKGRFQTPAEKHAFMGTLK
CIN10033|Rpl3        ------DGNASTESDITKKVITPLGGFPHYGVVKNDFLLVKGSIPGTKKRVITIRKSLMVHTSRRDLEKVTLKFIDTSSKFGHGSFQTVQEKHAFLGTLK
NEA10033|Rpl3        ------GSSGSTEFDLTKKDITPMGGFVRYGVVKNDFVMIKGSCVGPVKRIVTLRKALRTHTSRAHTEKVSLKFIDTSSNFGHGRFQDAAEKNAFLGQLK
MAY10033|Rpl3        ------KTSGSTDFDTTEKAITPLGGFPHYGLVKNDFVMIKGSCPGVKKRVLTLRKSLQVHTSRRALENVSLKWISTSSTMGKGVFQTPAEKDAFLGQRK
RHI10125|Rpl3        ------AKSGTTEYDLTEKQITPMGGFPHYGEVNEDFVMIKGCCAGAKKRVITLRKSLTVHTKRSALEKVTLKFIDTSSKFGHGRFQTPAEKHQFMGTLK
RHI10126|Rpl3-2      ------AKSGTTEYDLTEKQITPMGGFPHYGEVNEDFVMIKGCCAGAKKRVITLRKSLTVHTKRSALEKVTLKFIDTSSKFGHGRFQTPAEKHQFMGTLK
RHI10127|Rpl3-3      ------AKSGTTEYDLTEKQITPMGGFPHYGEVNEDFVMIKGCCAGAKKRVITLRKSLTVHTKRSALEKVTLKFIDTSSKFGHGRFQTPAEKHQFMGTLK
RHI10128|Rpl3-4      ------AKSGTTEYDLTEKQITPMGGFPHYGEVNEDFVMIKGCCAGAKKRVITLRKSLTVHTKRSALEKVTLKFIDTSSKFGHGRFQTPAEKHQFMGTLK
ARA10093|RPL3A       ---GTEAHTAMTEYDRTEKDVTPMGGFPHYGIVKDDYLMIKGCCVGPKKRVVTLRQSLLTQTSRLALEEIKLKFIDTASIFGHGRFQTSLEKMRFYNRVT
ARA10094|RPL3B       ---GQETHSAMTEYDRTEKDITPMGGFPHYGIVKEDYLMIKGCCVGPKKRVVTLRQTLLKQTSRLAMEEIKLKFIDAASNGGHGRFQTSQEKAKFYGRTI
RIC10106|RPL3B       ---GQESHAACTEFDRTEKDITPMGGFPHYGVVKGDYLMIKGCCVGPKKRVVTLRQSLLKQTSRLALEEIKLKFIDTSSKFGHGRFQTTDEKQRFFGKLK
RIC10107|RPL3A       ---GQESHAACTEFDRTEKDITPMGGFPHYGVVKGDYLMIKGCCVGPKKRVVTLRQSLLKQTSRLALEEIKLKFIDTSSKFGHGRFQTTDEKQRFFGKLK
GMA10166|LOC10081913 ---GDESHSALTEFDRTEKDITPIGGFPHYGVVKDDYIMVKGCCVGPKKRVITLRQSLLKQTSRVALEEIKLKFIDTSSKFGHGRFQTTQEKQKFFGRLK
GMA10167|LOC10080625 ---GDESHSALTEFDRTEKDITPMGGFPHYGVVKDDFIMVKGCCVGPKKRVITLRQSLLKQTSRVALEEIKLKFIDTSSKFGHGRFQTTQEKQKFFGRLK
GMA10168|LOC10079217 ---DQESHSAITEFDRTEKDITPMGGFPHYGVVKDDYIMVKGCCVGPKKRVITLRQSLLKQTSRVALEEIKLKFIDTSSKFGHGRFQTTQEKHKFYGRLK
GMA10169|LOC10078290 ---DHESHSAITEFDRTEKDITPMGGFPHYGVVKDDYIMVKGCCVGPKKRVITLRRSLLKQTSRVALEEIKLKFIDTSSKFGHGRFQTTQEKQKFYGRLK
POP10033|RPL3        ---GQETHTAITEYDRTEKDITPLGGFPHYGVVKDDYLMIKGCCVGPKKRVVTLRQSLLKQTSRLALEEIKLKFVDTSSKFGHGRFQTTQEKQKFYGRLK
CRE10033|RPL3        ---GDASHLATTEFDVTKKEITPMGGFPHYGVVSEDYLMIKGCVPGTKKRAITLRRSLLPQTSRNALEEVKLKFIDTASKFGHGRFQTTEEKLKTFGRTK
VOL10036|RPL3        ---GEASHLATTDFDVTKKEITPMGGFPHYGVVNEDYIMVKGAVPGTKKRAITLRRSLLPQTSRNALEEIKLKFIDTASKFGHGRFQTTEEKLKTYGRIK
HEM10030|rpl3        ------SNNGSTEFDLSTKKITPMGGFPYYGNVKEDFLLLKGCVMGSKKRQITLRKSLSQKPQNFFNKKIQLKFIDTSSKWGHGRFQTKDEKINAKNAE-
PTR10035|RPL3        ------EASCQTDADLTKKSITPMGGFVHYGEVKEDWLMLKGAIVGVKKRPLILRKSLMKHSSRKHLEKIDIKFIDTSSKLGHGRFQTAEEKAKFLGPLA
TPS10033|Rpl3        ------NSSCQTDADLTEKSITPMGGFVHYGQIREDWVMIKGACVGVKKRPLILRKSLMKHSSRKHLESIDLRFIDTSSKLGHGRFQTAEEKAKFLGPLA
CYA10034|RPL3        ------GKSATTEYDLTEKGITPLGGFPHYGVIREDWVMLRGAVQGPKKRPIILRKSLFPQISRRAQEKIELKFIDTSSKWGHGRFQTAAEKARYMGVLK
DIC10033|RPL3        -EDGKQISTGKTEFDLTEKTINPMGGFAHYGMVKHEFLMLKGCVAGPRKRALTLRKSITTQTGRAALEKITLKFIDTSSKFGHGLHQTAEDKTKYFGVKK
PLA10037|RPL3        ----TDKNSASTDADITEKKITPMGGFPHYGVVNEDFLLLKGCVAGTKKRPITLRKNIVPQVSRDALAQVSLKFIDTSSKIGHGRFQTSEEKVKYYGPLK
TGO10033|RPL3        ----ADPRNATTESDLTEKRITPMGGFPHYGTVNNDFLLLKGCIVGCKKRPITFRKTLVPRTTRRALEPVNLKFIDTSAKWGHGRFQTSEEKAKFYGPLK
GIA10033|Rpl3        ------PRCCTTEFDLTDKSINPVGGFVNYGRVQGDFIMIKGTCPGPKRRPVVMRNALLPHRN---CPPVQLQWISTASKFGHGIFETVEERRQFYAK--


HUM10034|RPL3        KDRIAKEEGA--------------
DOG10033|Rpl3        KDRIAKEEGA--------------
MUS10033|Rpl3        KDRIAKEEGA--------------
RAT10033|Rpl3        KDRIAKEEGA--------------
CHK10034|Rpl3        KDRIAKEEAA--------------
FUG10034|RPL3        KDRLAKEETA--------------
DAN10033|Rpl3        KDRLAKEEMA--------------
MED10033|Rpl3        KDRIAKEETA--------------
CIO10033|RPL3        KDRLAAAAAAATTTTTTA------
DRO10042|RpL3        KDRLKEEAAATTAAAAAATTTSA-
MOS10033|Rpl3        KDRIREEKAQAAAAAAAAAAKPSA
BEE10034|Rpl3        KDRMREEQQAQATTSAPSAANA--
CEL10033|rpl-3       RDFLAEAEAKA-------------
BMA10033|RPL3        KDFVAA------------------
STE10033|RPL3        SDREKELAAGAE------------
MBR10033|RPL3        KQLQSEE-----------------
NEU10034|Rpl3        KDLAASS-----------------
GRI10033|Rpl3        KDLVASS-----------------
GRA10034|Rpl3        KDLSSA------------------
YAR10034|Rpl3        KDL---------------------
POM10056|RPL3-1      KDVA--------------------
POM10057|RPL3-2      KDVA--------------------
YST10057|RPL3        KDL---------------------
CIN10033|Rpl3        SRA---------------------
NEA10033|Rpl3        IKSDA-------------------
MAY10033|Rpl3        IRAPVA------------------
RHI10125|Rpl3        KDL---------------------
RHI10126|Rpl3-2      KDL---------------------
RHI10127|Rpl3-3      KDL---------------------
RHI10128|Rpl3-4      KDL---------------------
ARA10093|RPL3A       K-----------------------
ARA10094|RPL3B       KA----------------------
RIC10106|RPL3B       A-----------------------
RIC10107|RPL3A       A-----------------------
GMA10166|LOC10081913 A-----------------------
GMA10167|LOC10080625 A-----------------------
GMA10168|LOC10079217 A-----------------------
GMA10169|LOC10078290 A-----------------------
POP10033|RPL3        A-----------------------
CRE10033|RPL3        A-----------------------
VOL10036|RPL3        A-----------------------
HEM10030|rpl3        ------------------------
PTR10035|RPL3        SKQNQ-------------------
TPS10033|Rpl3        SSGANKSA----------------
CYA10034|RPL3        RTAIST------------------
DIC10033|RPL3        SRSTKA------------------
PLA10037|RPL3        KDLKA-------------------
TGO10033|RPL3        SRAAAM------------------
GIA10033|Rpl3        ------------------------