CLUSTAL W (2.1) Multiple Sequence Alignments
HUM10064|RPL30       ----------MVAAKKTKKSLESINSRLQLVMKSGKYVLGYKQTLKMIRQGKAKLVILANNCPALRKSEIEYYAMLAKTGVHHYSGNNIELGTACGKYYR
DOG10063|Rpl30       ----------MVAAKKTKKSLESINSRLQLVMKSGKYVLGYKQTLKMIRHGKAKLVILANNCPALRKSEIEYYAMLAKTGVHHYSGNNIELGTACGKYYR
MUS10063|Rpl30       ----------MVAAKKTKKSLESINSRLQLVMKSGKYVLGYKQTLKMIRQGKAKLVILANNCPALRKSEIEYYAMLAKTGVHHYSGNNIELGTACGKYYR
RAT10063|Rpl30       ----------MVAAKKTKKSLESINSRLQLVMKSGKYVLGYKQTLKMIRQGKAKLVILANNCPALRKSEIEYYAMLAKTGVHHYSGNNIELGTACGKYYR
CHK10065|Rpl30       ----------MVAAKKTKKSLESINSRLQLVMKSGKYVLGYKQTLKMIRQGKAKLVILANNCPALRKSEIEYYAMLAKTGVHHYSGNNIELGTACGKYYR
FUG10064|RPL30       ----------MVAAKKTKKSMESINSRLQLVMKSGKYVLGYKQSQKMIRQGKAKLVILANNCPALRKSEIEYYAMLAKTGVHHYSGNNIELGTACGKYYR
DAN10063|Rpl30       ----------MVAAKKTKKSLESINSRLQLVMKSGKYVLGYKQSQKMIRQGKAKLVILANNCPALRKSEIEYYAMLAKTGVHHYSGNNIELGTACGKYYR
MED10063|Rpl30       ----------MVAAKKTKKSMESINSRLQLVMKSGKYVLGYKQSQKMIRQGKAKLVILANNCPALRKSEIEYYAMLAKTGVHHYSGNNIELGTACGKYYR
CIO10063|RPL30       ------------MVKKQKKALENINSRLRLVMKSGKYNLGYRQTLRMLRQGKAKLVILASNCPSLRKSEIEYYAMLAKTGVHHYTGNNIELGTACGKYFR
DRO10084|RpL30       ----------MVAVKKQKKALESTNARLALVMKSGKYCLGYKQTLKTLRQGKAKLVLIASNTPALRKSEIEYYAMLAKTEVQHYSGTNIELGTACGKYFR
MOS10064|Rpl30       ----------MVTAKKQKKALESINSRLALVMKSGKSCLGYKQTLRTLRQGKAKLVIIANNTPHLRKSEIEYYAMLAKTGVHHYNGNNIELGTACGKYFR
BEE10065|Rpl30       ----------MVAQKKQKKSQEGINSRLALVMKSGKYVLGYKQTLKSLRQGKAKLVIIANNAAPLRKSEIEYYAMLAKTGVHHYIGNNIELGTACGKYFR
CEL10067|rpl-30      --------MAPAAKPQVKKNAENINSRLSMVMKTGQYVLGYKQTLKSLLNGKAKLVIIANNTPPLRKSEIEYYAMLAKTGVHHYNGNNIELGTACGRLFR
BMA10063|RPL30       -----------MAVKKQKKSTENINARLAMVMKSGKYCLGYKQTLKTLRAGKAKLVIIANNTPPLRKSEIEYYAMLAKTGVHHYNGNNIELGTACGKLFR
STE10063|RPL30       ----------MVSSKKQKKAMESINSRLALVMKSGKFTLGLKSTLKTLRQGKAKLVIIANNTPQLRKSEIEYYAMLAKTGVHHYTGNNIELGTACGKYFR
MBR10063|RPL30       -----------MAGSKTKKSGESINQKLALVMKSGKYVLGYKSTLKALRSGKAKLVILASNTPPLRKSEIEYYALLSRSLVEHYKGDNIALGTACGKYFR
NEU10064|Rpl30       -----------MAPKKSKSDAQSIGAKLALVIKSGKVVLGYRSTLKALRSGKAKLILISANTPPLRKSELEYYSMMSKTAVHHYTGTNIELGTACGKLFR
GRI10063|Rpl30       -------------MAPKKKSTDNINSRLALVIKSGKVTLGYKSTLKSLRSNKAKLIIIAGNTPPLRKSELEYYSMLSKTPVHHFSGNNIELGTACGKLFR
GRA10064|Rpl30       ----------MAPQKKSKKDANSINSKLALVMKSGKVTLGYKSTLKSLRSGKAKLIIIAGNTPPLRKSELEYYSMLSKAPIHHFSGNNIELGTACGKLFR
STA10063|Rpl30       -----------MAPKKNKRTADSINSRLALVMKSGKVTLGYKSTLKSLRTGKAKLVIIAGNTPPLRKSELEYYAMLSKTSVHHFSGNNIELGTACGKLFR
YAR10064|Rpl30       ------------MAPKSKKSGDNVNAKLGLAIKSGKYTLGYKSTIKALRQGKAKLVIIAGNTPALRKSEIEYYAMLAKCTVHHFQGGNNELGTSCGRLFR
POM10112|RPL30-1     --------MASVVTKKSKKSGDTINAKLALTMKSGKYVLGYKSTLKTLRSGKAKLILIAGNCPPLRKSELEYYAMLSKANVHHYAGTNIDLGTACGKLFR
POM10113|RPL30-2     MSAAPTTAPVAAVSKKGKKSGDTINSKLALTMKSGKYVLGYKSTLKTLRSGKAKLILIAANAPPLRKSELEYYAMLSRCSVHHYSGNNIDLGTACGKLFR
YST10110|RPL30       --------------MAPVKSQESINQKLALVIKSGKYTLGYKSTVKSLRQGKSKLIIIAANTPVLRKSELEYYAMLSKTKVYYFQGGNNELGTAVGKLFR
CIN10064|Rpl30       --------MAPSKKSKSTKSTESIASRLALVVKSGKYSLGYKSALKQMRSGKAKLVLIAGNCPPLRKSELEYYAMLSKTTVHHFAGTNVALGTAAGKLFR
NEA10063|Rpl30       --------MAPVKKSKSAKNSESINSKLQLVVKSGKFTLGYKQALKQLRSGKAKLILISKNCPPLRKSEIEYYAMLSKTNVHHYDGSNVDLGTAAGKLYR
MAY10063|Rpl30       --------MAPKAKKSSQ---DNINTKLQLVIKSGKVALGLKSALKNMRSGKAKLVLISANTPPLRKSEIEYYAMLSKTAVHHYQGTNVALGTAAGKLFR
RHI10242|Rpl30       ----------MAPIAKSKKNAESINSRLQLVTKSGKYTLGYKSSLKTIRQGKAKLIIIAGNCPPLRKSEIEYYAMLSKTGVHHYNGNNIDLGTACGKLFR
RHI10243|Rpl30-2     ----------MAPVAKSKKNAESINSRLQLVTKSGKYTLGYKSSLKTIRQGKAKLIIIAGNCPPLRKSEIEYYAMLSKTGVHHYNGNNIDLGTACGKLFR
RHI10244|Rpl30-3     ----------MAPVAKSKKNAESINSRLQLVTKSGKYTLGYKSSLKTIRQGKAKLIIIAGNCPPLRKSEIEYYAMLSKTGVHHYNGNNIDLGTACGKLFR
ARA10174|RPL30A      ----------MVAAKKTKKSHEGINSRLALVMKSGKYTLGYKSVLKSLRSSKGKLILISSNCPPLRRSEIEYYAMLAKVGVHHYNRNNVDLGTACGKYFR
ARA10175|RPL30B      ----------MVTEKKTKKSHEGINSRLALVMKSGKYTLGYKSVLKSLRGSKGKLILISTNCPPLRRSEIEYYAMLAKVGVHHYNGNNVDLGTACGKYFR
ARA10176|RPL30C      ----------MVAEKKAKKSHEGINSRLALVMKSGKYTLGYKSVLKSLRSSKGKLILISSNCPPLRRSEIEYYAMLAKVGVHRYNGNNVDLGTACGKYFR
RIC10209|RPL30A      ----------MVAAKKTKKSTDNINNKLQLVMKSGKYTLGYKTVLRTLRNSKAKLVIISNNCPPLRKSEIEYYAMLAKVTVHHFHGNNVDLGTACGKYFR
RIC10210|RPL30B      ----------MAPTKKAKKSTDNINNKLQLVMKSGKYTLGYKTVLKTLRNSKGKLIILANNCPPLRKSEIEYYAMLGKVSVHHFHGNNVDLGTACGKYYR
GMA10324|LOC10077666 ----------MVAAKKTKKTHESINNRLALVMKSGKFTLGYKTVLKSLRNSKGKLIIIANNCPPLRKSEIEYYAMLAKVGVHHYNGNNVDLGTACGKYYR
GMA10326|LOC10080626 ----------MVAAKKTKKTHESINNRLALVMKSGKYTLGYKTVLKSLRSSKGKLIIIANNCPPLRKSEIEYYAMLAKVGVHHYNGNNVDLGTACGKYYR
GMA10327|LOC10079371 ----------MVAAKKTKKTHESINNRLALVMKSGKFTLGYKTVLKSLRSSKGKLIIIANNCPPLRKSEIEYYAMLAKVGVHHYNGNNVDLGTACGKYYR
POP10064|RPL30       ----------MVAAKKTKKTHESINNRLALVMKSGKYTLGYKTVLKSLRNSKGKLIIISNNCPPLRKSEIEYYAMLAKVGVHHYNGNNVDLGTACGKYFR
CRE10063|RPL30       ---------MAPATKKTKKTQENINARLALVMKSGKYTLGYKTCLKTLRSGKAKLVIICNNCPAVRKSEVEYYAMLAKTGVHHYGGNNVDLGTACGKYYR
VOL10068|RPL30       ---------MAPATKKTKKTQENINARLALVMKSGKYTLGYKTCLKTLRSGKAKLVIICNNCPAVRKSEVEYYAMLAKTGVHHYSGNNVDLGTACGKYYR
HEM10057|rpl30       -----------MTEKKNQKTTENLGNKLRLVVKSGKFTIGYNTTNKSLKEGECKIIIVANNCPSTRRLELEYLAMLNKSSIHHFYGNNSELGLACGKNFR
PTR10065|RPL30       -----------MVSKKAKKQQDSMNSRLKLVMKSGKAMLGYKASVKALRKGKAKMVLVASNCPHLRKSEVEYLAMLAKTQVHHYAGDNTAMGTACGKFFN
TPS10064|Rpl30       ---------MAPAGKKAKKNVESMNSRLKLVMKSGKAILGYKSGLKALRTGKSKMVLIASNCPPLRKSEVEYLAMLAKTTVHHYSGDNSELGTACGKLFN
CYA10064|RPL30       ----------MSATRKTRSVSEAINARLALVMKSGRYHLGYKSTLKSLRQGKCKLVIIASNCPRLRKSTLDYYAMLAKAQVYRYPASSIELGTACGRYFR
DIC10063|RPL30       ----------MVSVKKVKKSQENIGSKLALVMKSGKSQLGYKSTLKTLRAGKSKLILLASNLPSIRRSEIEYYAMLSKTTVHLYSGNNVDLGTALGRHYR
PLA10070|RPL30       -----------MAKKSKKSAGDNINAKLQLVMKSGKYQFGRKSCLKALRTGKGKLVIVSSNCPSIQRSVIEYYAMLSKCGVHDYHGDNNDLGTACGKLFR
TGO10063|RPL30       -----------MAKKAKKSGSEGINSRLQLVMKSGKVNLGCKTAIHALRTGKAKLIIISNNCPALRKSEIEYYAMLSKCGVHHYHGDNNELGTACGKLFR
GIA10063|Rpl30       ----------MSTKVATKKAQDSISLTLTLVVKSGKYTLGTDQAIRNIRDGKAQLVFMANNCPPLVKSQVDYLCHLSKTPVRVFAGSSRELGIAVGRQFN
MET10052|MJ1044      ---------------MRRRENMDVNKAIRTAVDTGKVILGSKRTIKFVKHGEGKLVVLAGNIPKDLEEDVKYYAKLSNIPVYQHKITSLELGAVCGKPFP
PYR10051|PHS043      ---------------------MDLAFELKKALETGKVILGSNETIRLAKTGGAKLIIVARNAPKEIKDDIYYYAKLSDIPVYEFEGTSVELGTLLGKPFV
SUL10059|ST0274      -----------------MAEVTGFESELKTLLRTGKVVFGSKKTIKMVKTGKVKMVIIASTLRQDLKDDILAYAKISNIPVYQYNGSAYELGTLCGKPFM


HUM10064|RPL30       VCTLAIIDPGDSDIIRSMPEQTGEK-----
DOG10063|Rpl30       VCTLAIIDPGDSDIIRSMPEQTGEK-----
MUS10063|Rpl30       VCTLAIIDPGDSDIIRSMPEQTGEK-----
RAT10063|Rpl30       VCTLAIIDPGDSDIIRSMPEQTGEK-----
CHK10065|Rpl30       VCTLAIIDPGDSDIIRSMPEQTSEK-----
FUG10064|RPL30       VCTLAIIDPGDSDIIRSMPDQQQPPQ----
DAN10063|Rpl30       VCTLAIIDPGDSDIIRSMPDQQQGGEK---
MED10063|Rpl30       VCTLAIIDPGDSDIIRSMPDQQPQPQ----
CIO10063|RPL30       VCTLSITDPGDSDIIRSMPAPSAGAGTGGD
DRO10084|RpL30       VCTLSITDPGDSDIIRSLETA---------
MOS10064|Rpl30       VCTLSITDAGDSDIIRSLPEAQAGGQ----
BEE10065|Rpl30       VCTLSITDPGNSDIIKSMPTGEQP------
CEL10067|rpl-30      VCTLAVTDAGDSDIILSVPSESA-------
BMA10063|RPL30       VCTLSITDAGDSDIIRSMPSENA-------
STE10063|RPL30       VSVLSITDPGDSDIIRSMPSEQQPAGGQ--
MBR10063|RPL30       VCTMAITDAGDSDIIRSVADAQ--------
NEU10064|Rpl30       CSTMAILDAGDSDILADQQQ----------
GRI10063|Rpl30       CGTMAILDAGDSDILADQQA----------
GRA10064|Rpl30       CSTMAILDAGDSDILSDQQA----------
STA10063|Rpl30       CSTMAIIDAGDSDILTTSTE----------
YAR10064|Rpl30       VGAVTIMDAGDSDILTAELS----------
POM10112|RPL30-1     VGVLAITDAGDSDILDA-------------
POM10113|RPL30-2     VGVLAVIDAGDSDILAA-------------
YST10110|RPL30       VGVVSILEAGDSDILTTLA-----------
CIN10064|Rpl30       VGVMTVIDQGDSDLLTFAEGASA-------
NEA10063|Rpl30       VGVMSIQDAGDSDLLQQQESA---------
MAY10063|Rpl30       VGVMTILDAGDSDLLSTVAA----------
RHI10242|Rpl30       TSVLSITDAGDSDILTAQ------------
RHI10243|Rpl30-2     TSVLSITDAGDSDILTAQ------------
RHI10244|Rpl30-3     TSVLSITDAGDSDILTAQ------------
ARA10174|RPL30A      VSCLSIVDPGDSDIIKSLPGDQ--------
ARA10175|RPL30B      VSCLSIVDPGDSDIIKSIPGDQ--------
ARA10176|RPL30C      VSCLSIVDPGDSDIIKTLPGDQ--------
RIC10209|RPL30A      VCCLSIIDPGDSDIIKTTGEQ---------
RIC10210|RPL30B      VCCLSIIDPGDSDIINTTPASQ--------
GMA10324|LOC10077666 VCCLSIIDPGDSDIIKTLPGDQ--------
GMA10326|LOC10080626 VCCLSIIDPGDSDIIKTLPGEQ--------
GMA10327|LOC10079371 VCCLSIIDPGDSDIIKTLPGEQ--------
POP10064|RPL30       VCCLSIIDPGDSDIIKSVPGDH--------
CRE10063|RPL30       VSVLAITDPGDSDIIKTVE-----------
VOL10068|RPL30       VSVLAITDPGDSDIIKTVE-----------
HEM10057|rpl30       CCCIGIIDPGDSDILNFLKK----------
PTR10065|RPL30       CSVLSITDAGDSDILTSGTKE---------
TPS10064|Rpl30       CSVVSIIDGGDSDILSSKE-----------
CYA10064|RPL30       VMVMAITDPGDSDILKAITEEAAGGSAAV-
DIC10063|RPL30       VSVMSITDAGDSDILTALNAKA--------
PLA10070|RPL30       ISCLVITDVGDSDIIKTNE-----------
TGO10063|RPL30       VSCLAVTDPGDSDIIRSVE-----------
GIA10063|Rpl30       VSIMTILEAGDADLTSILG-----------
MET10052|MJ1044      VAALLVLDEGLSNIMELVEKKEGGE-----
PYR10051|PHS043      VASLAIVDPGESRILALVKR----------
SUL10059|ST0274      ISTIGVIDPGESRLLEEIKEGAQ-------