CLUSTAL W (2.1) Multiple Sequence Alignments
HUM10065|RPL31       ---MAPAKKGGEKKKGRSAINEVVTREYTINIHKRIHGVGFKKRAPRALKEIRKFAMKEMGTPD--VRIDTRLNKAVWAKGIRNVPYRIRVRLSRKRNED
DOG10064|Rpl31       ---MAPAKKGGEKKKGRSAINEVVTREYTINIHKRIHGVGFKKRAPRALKEIRKFAMKEMGTPD--VRIDTRLNKAVWAKGIRNVPYRIRVRLSRKRNED
MUS10064|Rpl31       ---MAPAKKGGEKKKGRSAINEVVTREYTINIHKRIHGVGFKKRAPRALKEIRKFAMKEMGTPD--VRIDTRLNKAVWAKGIRNVPYRIRVRLSRKRNED
RAT10064|Rpl31       ---MAPAKKGGEKKKGRSAINEVVTREYTINIHKRIHGVGFKKRAPRALKEIRKFAMKEMGTPD--VRIDTRLNKAVWAKGIRNVPYRIRVRLSRKRNED
CHK10066|Rpl31       ---MAPAKKGSEKKKGRSAINEVVTREYTINIHKRIHGVGFKKRAPRALKEIRKFAMKEMGTPD--VRIDTRLNKAVWAKGIRNVPYRIRVRLSRKRNED
FUG10065|RPL31       ----MAPTKKGEKKKGRSAINEVVTREYTINVHKRIHGVGFKKRAPRAIKEIRKFAVKEMGTPD--VRIDTRLNKAVWSKGVRNVPYRIRVRLSRKRNED
DAN10064|Rpl31       -----MAPKKGEKKKGRSAINEVVTREYTINIHKRIHGISFKRRAPRALKEIRKFAVKEMGTPD--VRIDTRLNKAVWAKGVRNVPYRMRVRLSRKRNED
MED10064|Rpl31       ----MAPTKKGEKKKGRSAINEVVTREYTINIHKRIHGVGFKRRAPRAINEIRKFAMKEMGTPD--VRIDTRLNKAVWSKGVRNVPYRMRVRLSRKRNED
CIO10064|RPL31       ----MVSKKEKKGRSGVKAMKDVVTREYTIHMHKRIHGMGFKKRAPRAVKEIRKFALKMMGTSD--VRIDTRLNKFVWSQGVRNVPYRIRVRLARKRNED
DRO10085|RpL31       ------MTKTKGEKINKSAINEVVTRECTIHLAKRVHNIGFKKRAPRAIKEIRKFAEREMGTTD--VRIDTRLNKHIWSKGIRSTPFRIRVRLARRRNDD
MOS10065|Rpl31       ------MVKAKREKKPKSAINEVVTRECTINLNRRLHKVGYKKRSPRAIKIVRKFAEKEMGTTD--VRIDTRLNKAIWHRGIRNPPFRIRVRLSRRRNDD
BEE10066|Rpl31       -------MAKSKEKKGKSAMSEVVTREYTVNLHKRLHGVGFKKRAPRAIKEIRKFAEKQMGTPD--VRIDTRLNKQLWSKGIRNVPFRVRVRLSRRRNDD
CEL10068|rpl-31      -------MAPKNEKKSRSTINEVVTREYTIHIHARIRGIGSKKRAPRAIDEIKKFAKIQMKTND--VRVDTKLNKFIWSKGIKNVPYRVRVRLSRRRNED
BMA10064|RPL31       --MAPGKKGPKQERKPRSAMSEVVTREYTVNLHRRLHGVGFKKRAPQAIKAIRKFAEEQMGTKD--VRVHIRLNEFLWSKGVKNVPYRVRVRLSRRHNDD
STE10064|RPL31       ------MVKKTDKKKGRSAINEVVTREYTINLHKRIHGIGFKKRAPRAIKEIRKFAEKMMGTPD--VRIDTRLNKHVWNQGIRNVPYRVRVRLARKRNED
MBR10064|RPL31       --------------------MGPVAREYTIHLHKYIHGVGFKKRAPRAVKEIKKFAAKAMSTSD--VRVDQDLNKAVWATGVRNVPYRIRVRVERRRNED
NEU10065|Rpl31       -----MSSKKPTGKTQRSAIADVVAREYTIHMHKRMHGVTFKKRAPRAIKEIKEFAYKAMGTTD--VRIDPQLNKKVWEQGVKGVAYRLRVRISRRRNDE
GRI10064|Rpl31       ---MSTKTKKPTGKTQRSAIADVVAREYTIHLHKRLHGATFKKRAPKAIKEIKDFATKAMGTSD--VRVDPQLNKKVWEQGVKGVPYRIRVRISRRRNDS
GRA10065|Rpl31       ----MSSTKKPSGKTQRSAIADVVAREYTIHMHKRLHGVTFKKRAPKAIKEIKAFATKSMGTSD--VRIDPQLNKKVWEQGIKGVDYRIRVRISRRRNDE
STA10064|Rpl31       MAPSAKTGKKTAGKTGRSAIADVVAREYTIHLHKRVHGVSFKKRAPRAIKEIRGFAEKAMGTKD--VRLDPQLNKKVWESGIKGVPFRLRVRISRKRNDE
YAR10065|Rpl31       --------------MAKASINDVVTREYTIHLHKRVFGVQFKKRAPRAVKEIKKFAKLHMGTED--VRLDPALNKELWKRGIKGVPHRMRLRISRKRNDE
POM10114|RPL31       -----------MANTKKSAINQVVTRDYTIHMHKRLYGVSFKKRAPRAIKEIVAFAQKHMQTKE--VRVDPSLNKEVWKRGIRNVPHRLRLRLSRKRSDE
YST10111|RPL31A      ----------------MAGLKDVVTREYTINLHKRLHGVSFKKRAPRAVKEIKKFAKLHMGTDD--VRLAPELNQAIWKRGVKGVEYRLRLRISRKRNEE
YST10112|RPL31B      ----------------MAGLKDVVTREYTINLHKRLHGVSFKKRAPRAVKEIKKFAKLHMGTED--VRLAPELNQAIWKRGVKGVEYRLRLRISRKRNEE
CIN10065|RPL31       ---MATATKKKTGGKTRSALQDVVTREYTIHLHKRVHGRSFKKRAPWAVKSIIEFSQKHMGTSD--VRLDPKLNQAVWSQGIKSVPHRLRLRLERKRNDD
NEA10064|RPL31       ----MVATKERKTRTPRSALHDVVTREYTIHLHKRVHDLSFKKKAPKAIKEIVKFAQKSMGVND--VRVSPGLNQAVWARGVRSPPRRIRVRLERKRNDD
MAY10064|Rpl31       --MADHKDKSQKGKKTRSALNDVVTREYTVNLHKRVHDVAFKKRAPRAIKEVVAFAQKAMGTKD--VRLDPKLNQEVWKYGVKNFPRRLRVRLERKRNDD
RHI10245|Rpl31       --------MAKSTPQKRSTLADVVTREYTIHLHKHVFGRSLRKRTPHAVKAVKAFAEKAMGTKD--VRLDPALNKSLWSRGVKHINHRIRVRIARKRNDD
RHI10246|Rpl31-2     --------MAKSTPQKRSTLADVVTREYTIHLHKHVFGRSLRKRTPHAVKAVKAFAEKAMGTKD--VRVDPALNKALWSRGVKHINHRIRVRIARKRNDD
RHI10247|Rpl31-3     --------MVKSTPQKRSVLNDVVVREYTIRFHRYVFGRSFRKRTPHAIKAVKDFAEKAMGTKD--VRLDPTLNRILWSRGVKHINHRMRVRIVRRRNDD
RHI10248|Rpl31-4     -------MVKDQKTPKRSTLADVVTREYTIHLHKHVFGRSLRKRTPHAVKAVKAFAEKAMGTKD--VRLDPALNKSLWSRGVKHINHRIRVRIARKRNDD
ARA10177|RPL31A      ------------MEKGKGRKEEVVTREYTINLHRRLHSCTFKKKAPNAIKEIRKFALKAMGTKD--VRVDVKLNKQIWSKGIRGPPRRIRVRVARKRNDD
ARA10178|RPL31B      ------------MSEKKGRKEEVVTREYTINLHRRLHSCTFKKKAPKAIKEIRKFAEKEMGTKD--VRVDVKLNKQIWSKGIRGPPRRIRVRVARKRNDD
ARA10179|RPL31C      ------------MSEKKGRKEEVITREYTINLHRRLHKCTFKKKAPKAIKEIRKFAEKAMGTKD--VRVDVKLNKQIWSKGIRGPPRRIRVRVARKRNDD
RIC10212|RPL31C      ---------MVEKKGGAARKEEVVTREYTINLHKRLHSCTFKKKAPNAIKEIRKFAQKAMGTTD--VRVDVKLNKHIWSSGIRSVPRRVRVRIARKRNDE
RIC10213|RPL31A      --------MSEKKRGAGTRKDEVVTREYTINLHKRLHGCTFKKKAPNAIKEIRKFAQKAMGTTD--IRIDVKLNKAIWTNGIRSVPRRVRVRISRKRNDE
RIC10214|RPL31B      -------MAEKKQRPGGARKDEVVTREYTINLHKRLHGCTFKKKAPNAIKEIRKFAQKAMGTID--VRVDVKLNKHIWSSGIRSVPRRVRVRIARRRNDE
GMA10328|LOC10030558 -----------MVEKAKGRKEEVVTREYTINLHKRLHGCTFKKKAPKAIKEIRKFAQKAMGTND--VRVDVKLNKFVWSQGIRSVPRRIRVRIARKRNDD
GMA10329|LOC10081083 -----------MVEKAKGRKEEVVTREYTINLHKRLHGCTFKKKAPKAIKEIRKFAQKAMGTND--VRVDVKLNKFVWSQGIRSVPRRIRVRIARKRNDD
GMA10330|LOC10049974 -----------MVEKAKGRKEEVVTREFTINLHKRLHGCTFKKKAPKAIKEIRKFAQKAMGTND--VRVDVKLNKAVWSQGIRSVPRRIRVRIARKRNDD
GMA10331|LOC10030633 -----------MVEKAKGRKEEVVTREYTINLHKRLHGCTFKKKAPKAIKEIRKFAQKAMGTND--VRVDVKLNKAVWSQGIRSVPRRIRVRIARKRNDD
POP10065|RPL31       -----------MVEKTKGRKEEVVTREYTINLHKRLHGCTFKKKAPKAIKEIRKFALKAMGTKD--VRVDVKLNKHIWSRGIRSVPRRIRVRISRRRNDD
CRE10064|RPL31       ------------MAKDKSRSKEQVTREYTIHLSKRLHKTSFKKCAPKAVKEIRKFASKVMGTSD--VRLDVKLNKAVWSKGIKNVPTRLRIVISRRRNDD
VOL10069|RPL31       ------------MAKEKSRSKEQVTREYTIHLSKRLHKTSFKKCAPKAVKEIRKFAAKVMGTSD--VRLDVKLNKAVWAKGIKNVPTRLRIVISRRRNDD
HEM10058|rpl31       -----------------MGQEFDYSIECNLNLHKRMHGIKFKRRVPQAILEIKKFAQKVMNSKN--IRIDTQLNKFLWLKGTKHTPIRVRILLVKKRFVS
PTR10066|RPL31       -------------MVKGAPKPDLVTRDYTIQLSKRIHKMQFKRRAPRAVKEIRKFAQTAMGTSD--VRISSELNKEVWKRGIKNVPTRVRVRLSRKRNED
CYA10065|RPL31       ----------MVRATKQALLKEDVTREYTIHLHKYIHSVVFKKRAPRAIAAIKAFARRTMGTED--VRIDAKVNKEVWKNGIRGVPNRVRVRLSRRRADT
DIC10064|RPL31       -----------------MSSSEAVTREYTINLHKRLYGTTFKDRAPKAVKQVKLFAQKIMGTKD--VRIDNKLNKFLWSQGIKNVPHRVRVTLSRKRNED
PLA10071|RPL31       --------MVKGTVKKQKKTLKPVTKFITINLSKLTHKVCYKRKAPRAIKEIRSIAGKLMHTKD--VRLDVKLNKFIWSKGVRNPPKRVRVKLERKRNED
TGO10064|RPL31       --------MKGTTRKAQNKSLQPVCRDYTIHLHKLIHGIQFKKRAPRALREIRRFAQKTMHTKD--VRIDTKLNKFIWSGGIRNVPRRVRVRIARRRNDD
GIA10064|Rpl31       ---------------------MGIVYEHTIRLNKAVRGKPSKKAAPIAIRAIRAQVEKLAKVED--VRLDPSVNVFVWSRGIRHVPRRIRLEVRLEGDDE
HAL10051|VNG2467G    -----------------MSASEFDDRFVTVPLRDVT-KVPSHERAGEAMNIIRQHLAKQFAVDEDAVRLDPSINDAVWSEGNNNPPRKLRVHAGSFAEDG
MET10054|MJ0049      -----------------LEVLMMEERIYTIPLRDVINKSVRTKRAPRAIKKIKQFLKRHMKAEI--VKIDNELNEKIWERGIQKPPARVRVKAVKE----
PYR10052|PH0529a     ----------------VRMIKPGEEVIFTVPIRKVKKIVPRWKRAPRAVKFVREFIARHAKAQE--VIISTKVNEKIWERGIEKPPSKLRVKVRVEEEER
SUL10060|STS168      -------------------MKEKDNFEMVINFKRAFMGRRN-QRTKRAIKMIRNIVQRHFGAEK--VIIDPLLAKSITYNGRDKIVRKVRVAVKKIGEKT


HUM10065|RPL31       EDSPNKLYTLVTYVP--VTTFKNLQTVNVDEN--
DOG10064|Rpl31       EDSPNKLYTLVTYVP--VTTFKNLQTVNVDEN--
MUS10064|Rpl31       EDSPNKLYTLVTYVP--VTTFKNLQTVNVDEN--
RAT10064|Rpl31       EDSPNKLYTLVTYVP--VTTFKNLQTVNVDEN--
CHK10066|Rpl31       EDSPNKLYTLVTYVP--VTTFKGLQTVNVDEN--
FUG10065|RPL31       EDSPNKLYTLVTYVP--VTTCKGLQTVNVDEN--
DAN10064|Rpl31       EDSPNKLYTLVTYVP--VTTYKGLQTVNVDEN--
MED10064|Rpl31       EDSPNKLYTLVTYVP--VTTCKGLQTVNVDEN--
CIO10064|RPL31       EDSANKLYTLVTYVP--VATFKGLNTVNVDADE-
DRO10085|RpL31       EDSPNKLYTYVTYVP--VSTFKNLQTENVESSDD
MOS10065|Rpl31       EDSPNKLYTLVTYVP--VPTFKELQTENVESTED
BEE10066|Rpl31       EDSANKLYTLVTYIP--VASFKGLQTENVDASQD
CEL10068|rpl-31      EDSAQKLYTLCTYVP--CTNFHGLTNVNVDSEE-
BMA10064|RPL31       ESSADRLYTLVTHVP--VTTFKKLTTVNVDNEE-
STE10064|RPL31       EDSPHKLYTLVTSVA--VSTFKGLQTQKVESEE-
MBR10064|RPL31       EDAKEEFYSYVSYVP--VASFKGLTTVKVEGGEA
NEU10065|Rpl31       EGAKEKLYSYVQAVN--VKNPKGLHTVVVEE---
GRI10064|Rpl31       EDAKEKLYSYVQAVN--TKNPKGLHTVLVDE---
GRA10065|Rpl31       EGAKEKLYSYVQAVN--VKDPKGLPTVVVEE---
STA10064|Rpl31       EGAKEKLYSYVQAVN--VKDPKGLHTQVVEDA--
YAR10065|Rpl31       ENAKEKLFSYVQAVN--VPSAKGLETTVVEVDEE
POM10114|RPL31       D--DKALYTYVQAVD--VANPKMETTVVEE----
YST10111|RPL31A      EDAKNPLFSYVEPVL--VASAKGLQTVVVEEDA-
YST10112|RPL31B      EDAKNPLFSYVEPVL--VASAKGLQTVVVEEDA-
CIN10065|RPL31       ENAKEKLYTYVSHVP--VTSFKGLETTVIEADE-
NEA10064|RPL31       EGAKEKLYVVASVVEG-VTSFKGLQTVVVENDE-
MAY10064|Rpl31       EGAKEKLYTYAVPVLG-LGTAKGLQTTVIDQE--
RHI10245|Rpl31       ENAKEKLYSYVTYVP--VASFKAFQIAVV-----
RHI10246|Rpl31-2     ENAKEKLFSYVTYVP--VASFKGLETAVVDDNE-
RHI10247|Rpl31-3     DNAKEKFYSYVTHVP--VTMFKYLTTVVVEYE--
RHI10248|Rpl31-4     ENAKEKLYSYVTYVP--VASFKGLETQVVDDEA-
ARA10177|RPL31A      EDAKEEFFSLVTVAEIPAEGLSGLGTKVIEEEE-
ARA10178|RPL31B      EDAKEEFFSLVTVAEIPAEGLSGLGTKIIEEED-
ARA10179|RPL31C      EDAKEEFFSLVTVAEIPAEGLSGLGTKVIEEED-
RIC10212|RPL31C      EDAKEELYSLVTVAEVPPEGLKGLGTKVVDETD-
RIC10213|RPL31A      EDAKEELYSLVTVAEIPAEGLKGLGTKVVEDEE-
RIC10214|RPL31B      EDAKEELYSLVTVAEVPQEGLKGLGTKLVEDDE-
GMA10328|LOC10030558 EDAKEELYSLVTVVEIPKDELKGLGTKVIDDED-
GMA10329|LOC10081083 EDAKEELYSLVTVVEIPKDELKGLGTKVIDDED-
GMA10330|LOC10049974 EDAKEELYSLVTVVEIPKDELKGLGTKVIDDED-
GMA10331|LOC10030633 EDAKEELYSLVTVVEIPKEELKGLETKVIDDED-
POP10065|RPL31       EDAKEELYSLVTVAELPPEGTKGLGTKVIEEDD-
CRE10064|RPL31       EDAKEEMYSFVTVAED--QSTKGKGTVVVQDA--
VOL10069|RPL31       EDAKEEMYSFVTVADD--QSTKGKGTVVVQDD--
HEM10058|rpl31       DNFDGWVIFVFLSKN---ENFKNQLTKIKK----
PTR10066|RPL31       EDADEKLYTLVDILI--VESFKGLQTENYVEA--
CYA10065|RPL31       DASKPKLYTYVTLVP--VTSFRGLQTVNVDE---
DIC10064|RPL31       ENATEKLYTVASLVI--VKSFKGLQTKKVADN--
PLA10071|RPL31       EDSKEKMYTIVEHVM--VDSYKGLVNECEANE--
TGO10064|RPL31       EDSKEKFYTLVQHVP--VASFENLKTEYVNEE--
GIA10064|Rpl31       HKFAYVINKDVENFKHLTTEKKGSEDGSE-----
HAL10051|VNG2467G    ETVVEADYEG------------------------
MET10054|MJ0049      --GNVVIATLAE----------------------
PYR10052|PH0529a     EGGKVRIAYVDLA---------------------
SUL10060|STS168      YLVRLALKSE------------------------