CLUSTAL W (2.1) Multiple Sequence Alignments
THE10048|TTHA1073    -VKEGIHPKLV-PARIICGCGNVIETYSTK-PEIYVEVCSKCHPFYTGQQRFVDTEGRVERFQRRYGDSYRKGR--------
SYN10048|ssl3445     MPKADIHPTWYPDAKVTCNGEVIMTVGSTK-PEINVEIWSGNHPFYTGTQKIIDTEGRVDRFMRKYGMKEKTTGDKQDKKKK
BAC10049|Bsu3705     -MKAGIHPNFK-KATVKCACGNEFETGSVK-EEVRVEICSECHPFYTGRQKFASADGRVDRFNKKYGLK-------------
ECO10049|rpmE        -MKKDIHPKYE-EITASCSCGNVMKIRSTVGHDLNLDVCSKCHPFFTGKQRDVATGGRVDRFNKRFNIPGSK----------