CLUSTAL W (2.1) Multiple Sequence Alignments
HUM10066|RPL32       ----------------------------------------------------------------------------------------------------
DOG10065|Rpl32       ----------------------------------------------------------------------------------------------------
MUS10065|Rpl32       ----------------------------------------------------------------------------------------------------
RAT10065|LOC362421   ----------------------------------------------------------------------------------------------------
CHK10067|Rpl32       ----------------------------------------------------------------------------------------------------
FUG10066|RPL32       ----------------------------------------------------------------------------------------------------
DAN10065|Rpl32       ----------------------------------------------------------------------------------------------------
MED10065|Rpl32       ----------------------------------------------------------------------------------------------------
CIO10065|RPL32       ----------------------------------------------------------------------------------------------------
DRO10086|RpL32       ----------------------------------------------------------------------------------------------------
MOS10066|Rpl32       ----------------------------------------------------------------------------------------------------
BEE10067|Rpl32       ----------------------------------------------------------------------------------------------------
CEL10070|rpl-32      ----------------------------------------------------------------------------------------------------
BMA10065|RPL32       ----------------------------------------------------------------------------------------------------
STE10065|RPL32       ----------------------------------------------------------------------------------------------------
MBR10065|RPL32       ----------------------------------------------------------------------------------------------------
NEU10066|Rpl32       ----------------------------------------------------------------------------------------------------
GRI10065|Rpl32       ----------------------------------------------------------------------------------------------------
GRA10066|Rpl32       ----------------------------------------------------------------------------------------------------
STA10065|Rpl32       ----------------------------------------------------------------------------------------------------
YAR10066|Rpl32       ----------------------------------------------------------------------------------------------------
POM10115|RPL32-1     ----------------------------------------------------------------------------------------------------
POM10116|RPL32-2     ----------------------------------------------------------------------------------------------------
YST10113|RPL32       ----------------------------------------------------------------------------------------------------
CIN10066|RPL32       ----------------------------------------------------------------------------------------------------
NEA10065|Rpl32       ----------------------------------------------------------------------------------------------------
MAY10065|Rpl32       ----------------------------------------------------------------------------------------------------
RHI10249|Rpl32       ----------------------------------------------------------------------------------------------------
RHI10250|Rpl32-2     ----------------------------------------------------------------------------------------------------
RHI10251|Rpl32-3     ----------------------------------------------------------------------------------------------------
RHI10252|Rpl32-4     ----------------------------------------------------------------------------------------------------
RHI10253|Rpl32-5     ----------------------------------------------------------------------------------------------------
ARA10180|RPL32A      ----------------------------------------------------------------------------------------------------
ARA10181|RPL32B      ----------------------------------------------------------------------------------------------------
RIC10215|RPL32A      ----------------------------------------------------------------------------------------------------
RIC10216|RPL32B      ----------------------------------------------------------------------------------------------------
RIC10217|RPL32A      ----------------------------------------------------------------------------------------------------
GMA10332|LOC10080318 ----------------------------------------------------------------------------------------------------
GMA10333|LOC10049994 ----------------------------------------------------------------------------------------------------
GMA10334|LOC10052777 ----------------------------------------------------------------------------------------------------
GMA10335|LOC10080318 ----------------------------------------------------------------------------------------------------
GMA10336|LOC10030640 ----------------------------------------------------------------------------------------------------
GMA10337|LOC10049984 ----------------------------------------------------------------------------------------------------
GMA10338|LOC10078756 ----------------------------------------------------------------------------------------------------
POP10066|RPL32       ----------------------------------------------------------------------------------------------------
CRE10065|RPL32       ----------------------------------------------------------------------------------------------------
VOL10070|RPL32       ----------------------------------------------------------------------------------------------------
HEM10059|rpl32       ----------------------------------------------------------------------------------------------------
PTR10067|RPL32       ----------------------------------------------------------------------------------------------------
TPS10066|Rpl32       ----------------------------------------------------------------------------------------------------
CYA10066|RPL32       ----------------------------------------------------------------------------------------------------
DIC10065|RPL32       ----------------------------------------------------------------------------------------------------
PLA10072|RPL32       ----------------------------------------------------------------------------------------------------
TGO10065|RPL32       ----------------------------------------------------------------------------------------------------
GIA10065|Rpl32       ----------------------------------------------------------------------------------------------------
HAL10052|VNG1711G    MSDENDTPEELADISGVGPSKAEALAEAGFESVADVQAADQSELAEADGIGNALAARIKADVGGLEVEADTDAEVEEVGGDDEADTDADVETELRARGLT
MET10055|MJ0472      ----------------------------------------------------------------------------------------------------


HUM10066|RPL32       -----MAALRPLVKPKIVKKRTKKFIRHQSDRYVKIKRN-WRKPRGIDNRVRRRFKGQILMPNIGYGSNKKTKHMLP--SGFRKFLVHNVKELEVLLMCN
DOG10065|Rpl32       -----MAALRPLVKPKIVKKRTKKFIRHQSDRYVKIKRN-WRKPRGIDNRVRRRFKGQILMPNIGYGSNKKTKHMLP--SGFRKFLVHNVKELEVLLMCN
MUS10065|Rpl32       -----MAALRPLVKPKIVKKRTKKFIRHQSDRYVKIKRN-WRKPRGIDNRVRRRFKGQILMPNIGYGSNKKTKHMLP--SGFRKFLVHNVKELEVLLMCN
RAT10065|LOC362421   -----MAALRPLVKPKIVKKRTKKFIRHQSDRYVKIKRN-WRKPRGIDNRVRRRFKGQILMPNIGYGSNKKTKHMLP--SGFRKFLVHNVKELEVLLMCN
CHK10067|Rpl32       -----MPALRPLVKPKIVKKRTKKFIRHQSDRYVKIKRN-WRKPRGIDNRVRRRFKGQILMPNIGYGSNKKTKHMLP--TGFRKFLVHNVKELEVLMMSN
FUG10066|RPL32       -----MAALRPLTKPKIVKKRTKKFIRHQSDRYVKIARN-WRKPRGIDNRVRRRFKGQMLMPNIGYGSNKKTKYMLP--TGFKKFLVHNVKELEVLMMSN
DAN10065|Rpl32       -----MAALRPLTKPKIVKKRTKKFIRHQSDRYVKIRAN-WRKPRGIDNRVRRRFKGQMLMPNIGYGSNRKTKHMLP--SGFKKFLVHNVKELEVLMMSN
MED10065|Rpl32       -----MAALRPLTKPRLIKKRTKKFIRHQSDRYVKIKQN-WRKPRGIDNRVRRRFKGQMLMPNIGYGSNKKTKFILP--TGFKKFLVPNVKELEVLMMSN
CIO10065|RPL32       ------MSPRPINQKKIVKKRVKKFIRHQSDRYKKLAPN-WRKPKGIDSRVRRRFKGQYLMPSIGYGSEKKTRHCMRDHHGFRKLLVHNVRDLEVLMMSN
DRO10086|RpL32       ------MTIRPAYRPKIVKKRTKHFIRHQSDRYAKLSHK-WRKPKGIDNRVRRRFKGQYLMPNIGYGSNKRTRHMLP--TGFKKFLVHNVRELEVLLMQN
MOS10066|Rpl32       ------MAVRPAYKPKIVKKRTKKFIRHQSDRYDKLAPN-WRRPKGIDNRVRRRFKGQYLMPNIGYGSKKSTRHMLP--TGFKKFLVHNVRELEVLMMQN
BEE10067|Rpl32       ------MAIRPVYRPTIVKKRTKKFIRHQSDRYSKLKRN-WRKPKGIDNRVRRRFKGQYLMPNIGYGSNKKTRHMLP--TGFRKVLVHNVKELEVLMMQN
CEL10070|rpl-32      ------MVHVSGTKVKVVKKKLTKFKRHESDRYRRVAPS-WRKPKGIDNRVRRRFRGMRAMPTIGHGSDRRTRFVLP--NGYKKVLVQNVKDLDMLLMQS
BMA10065|RPL32       ------MVLVDGKRVKIVKKHRRRFTRHESDRYHRLRPN-WRKPKGIDNRVRRRFKGQRRMPKIGYGNAKATRHMLP--NGFRKVLIHNVKDLDMLLMQN
STE10065|RPL32       -------MVMPVNRPRILKKRQKKFIRHQSDRYMRVGES-WRKPKGIDNRVRRRFKGQYLMPNIGYGSNKKTRFLMP--DGFKKFVVHNVKELEVLMMMN
MBR10065|RPL32       -------MVMPANRRKIVKKRTKAFKRMHWDRYKCVDPS-WRKPHGIDGRFRRRFHGLQKHPKIGYGSNQQTRHMMP--DGFKKFLVRAPEDLEVLLMHN
NEU10066|Rpl32       -------MVAAKKHVPIVKKRSKGFMRHQSDRFMRVDSA-WRKPKGIDNRVRRRFRGTLAMPSIGYGSNKKTRHMMP--SGHKAFLVSNVKDVELLLMHN
GRI10065|Rpl32       -------MVAAAKHTAIVKKRTKSFMRHQSDRFKRVDPS-WRKPKGIDNRVRRRFRGNIAMPSIGYGSNKRTKHMMP--SGHKAFLVQNINDVELLLMHN
GRA10066|Rpl32       -------MVSAKKHVPIVKKRTKRFERHQHDRFMRVSPS-WRKPKGIDSRVRRRFRGTIAMPSIGYGSNKKTRYMAP--SGFKAFIVSNKSDLELLLMHN
STA10065|Rpl32       -------MVAAKKHVAIVKKHPKRFNRHQSDRFKCVDPS-WRKPKGIDNRVRRRFKGQAAMPKIGYGSNRKTRHLMP--SGHKAFLVANVADVDLLLMHN
YAR10066|Rpl32       -------MAASNPHPKIVKKHRKAFKRHQSDRFDRVGES-WRKPKGIDSCVRRRFRGTIRMPKIGYGSAKATKHMMP--SGHKAFLVSNTEEVELLLMHT
POM10115|RPL32-1     -----------MAAINIVKKRTKPFKRHQSDLFKRVGES-WRKPRGIDSCVRRRFRGTISMPKIGYGNNKKTRYCMP--NGLKAFLVRNVSDVELLLMHN
POM10116|RPL32-2     -----------MAAVNIIKKRTKPFKRHQSDRFKRVGES-WRKPRGIDSCVRRRFRGTISMPKIGYGNNKKTRYCMP--NGLKAFLVRNVSDVELLLMHN
YST10113|RPL32       --------MASLPHPKIVKKHTKKFKRHHSDRYHRVAEN-WRKQKGIDSVVRRRFRGNISQPKIGYGSNKKTKFLSP--SGHKTFLVANVKDLETLTMHT
CIN10066|RPL32       ------------MAIKIVKKRTNKFKRHQSDRYHGVKEA-WRKPKGIDNRVRRRFKGQTAMPKIGYGSNKKTRHLLP--NGLKKFLVSNVRDLDVLLLHN
NEA10065|Rpl32       ----------MPAHIPIVKKRTKHFKRHQSDRYHGVKES-WRKPKGIDNRVRRRFKGQIPMPKIGYGSNQKTRHLLP--SGHKELLVHNLSELELLLMHS
MAY10065|Rpl32       ---------MAATSIPIVKKRTKAFKRHHSDRYHRVGES-WRKPKGIDSAVRRRFRSTVRMPKIGYGSNKKTRHLMP--NGYRRLVVSNVRDVELLLMHN
RHI10249|Rpl32       -------MVTPAVKHTIIKKRTAHFKRHQSNRFMRVGES-WRKPKGIDCNMRRRFKGQAPMPKIGYGSAKKTRNLLP--NGFRKFTVSNVRELNLLLMHN
RHI10250|Rpl32-2     -------MVTPAVKHTIVKKRTAHFKRHQSNRFMRVGES-WRKPKGIDCNMRRRFKGQAPMPKIGYGSAKKTRNLLP--NGFRKFTVSNVRELNLLLMHN
RHI10251|Rpl32-3     -------MVTPAVKHTIVKKRTAHFKRHQSNRFMRVGES-WRKPKGIDCNMRRRFKGQAPMPKIGYGSAKKTRNLLP--NGFRKFTVSNVRELNLLLMHN
RHI10252|Rpl32-4     -------MVTPAVKHTIVKKRTAHFKRHQSNRFMRVGES-WRKPKGIDCNMRRRFKGQAPMPKIGYGSAKKTRNLLP--NGFRKFTVSNVRELNLLLMHN
RHI10253|Rpl32-5     -------MVTPAVKHTIIKKRTAHFKRHQSNRFMRVGES-WRKPKGIDCNMRRRFKGQAPMPKIGYGSAKKTRNLLP--NGFRKFTVSNVRELNLLLMHN
ARA10180|RPL32A      -------MAVPLLTKKVVKKRSAKFIRPQSDRRITVKES-WRRPKGIDSRVRRKFKGVTLMPNVGYGSDKKTRHYLP--NGFKKFVVHNTSELELLMMHN
ARA10181|RPL32B      -------MAVPLLTKKVVKKRSAKFIRPQSDRRITVKES-WRRPKGIDSRVRRKFKGVTLMPNVGYGSDKKTRHYLP--NGFKKFIVHNTSELELLMMHN
RIC10215|RPL32A      -------MAVPLLTKKIVKKRVKQFKRPHSDRYLCLKPS-WRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLP--NKFKKFVVHNVSELELLMMHN
RIC10216|RPL32B      -------MAVPLLTKKIVKKRVKQFKRPHSDRYIGLKTS-WRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLP--NKFKKFVVHNVSELELLMMHN
RIC10217|RPL32A      -------MAVPLLTKKIVKKRVKQFKRPHSDRYIGLKTS-WRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLP--NKFKKFVVHNVSELELLMMHN
GMA10332|LOC10080318 -------MAVPLLSKKIVKKRVKKFKRPQSDRKISVKTN-WRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLP--NGFKKFVVHNVKDLELLMMHN
GMA10333|LOC10049994 -------MAVPLLSKKIVKKRVKKFKRPQSDRKISVKTN-WRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLP--NGFKKFVVHNVKDLELLMMHN
GMA10334|LOC10052777 -------MAVPLLSKKIVKKRVKKFKRPQSDRKISVKTN-WRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLP--NGFKKFVVHNVKDLELLMMHN
GMA10335|LOC10080318 -------MAVPLLSKKIVKKRLKKFKRPQSDRKISVKTN-WRRPKGIDSRVRRKFKGCTLMPNIGYASDKKTRHYLP--NGFKKFVVHNVKDLELLMMHN
GMA10336|LOC10030640 -------MAVPLLSKKIVKKRVKKFIRPQSDRKISVKPS-WRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLP--NGFKKFVVHNVKDLELLMMHN
GMA10337|LOC10049984 -------MAVPLLSKRIVKKRVKKFIRPQSDRKISVKPS-WRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLP--NGFKKFVVHNVKDLELLMMHN
GMA10338|LOC10078756 -------MAVPLLSKKIVKKRVKKFKRPQSDRKISVKTN-WRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLP--NGFKKFVVHNVKDLELLMMHN
POP10066|RPL32       -------MAVPLLTKKIVKKRVKKFKRPQSDRKISVKTN-WRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLP--NGFKKFVVHNVKELEVLMMHN
CRE10065|RPL32       -------MVQPLKKVKIVKKRTKHFDRHQSDRKDSIKTS-WRKPKGIDNRVRRRFKGALPMPNIGYGSNAKTRHTLP--NGFLKYTVNNVKDLELLMMHN
VOL10070|RPL32       -------MVQPLKKVKIVKKRTKHFDRHQSDRKDSIKPS-WRRPKGIDNRVRRRFKGALPMPNIGYGSNNKTKHMLP--NGFLKYTVHNVKDLELLMMHN
HEM10059|rpl32       ----------MVKKIPVIKKKIKKFNRHHSDRYKRLKKN-WRKPKGIDSCVRRRFKGRTLMPNIGYGSDKRTKNFLK--NGLFKVKIENIRELKSLAMSN
PTR10067|RPL32       -----MAGPTPLNKKTIVKKRTKKFARHQSDLFLRIANSSWRKPKGIDGRVRRRFKGSIPMPSIGYGSDKQTRNVHP--HGFKTVVINNVSELEMLMMHN
TPS10066|Rpl32       -----MAGTQPLCKKTIIKKRTKKFARHQSDQFMRIQRSSWRKPKGIDGRVRRRFKGAVPMPSIGYGSDKKTRNVLP--CGFRSVVVNNVGELEMLMMHN
CYA10066|RPL32       -------MPEPLEHVRVVKKRTKRFRRHQSDRFKRVKES-WRRPKGIDSAVRRRFNGKTLMPNIGYGSARKTRHMLP--SGFFPFLVHNSKDLECLLMHN
DIC10065|RPL32       -------MPSPINRTKIVKKKTTKFNRFQSDLFKRVGAS-WRKPRGIDNRVRRRFSGSRAMPSIGFGSAKATKDVCP--DGFKRFVIRNVQELEVLLMQN
PLA10072|RPL32       ---MAVKKVG-----KIIKKRTKKFTRFQSNRFMRVKPA-WRKPRGIDCRVRRRYKGTNLMPSIGYGSNKKTKFLLP--NNKYKYVVKNVKEMEPLIMNH
TGO10065|RPL32       ------MAPVSTVKRSIVKKRVKSFPRFQSDRYKRVKSS-WRKPKGIDCRVRRKFKGTNTMPNIGYGSNKKTRHMLP--NGFFKFLVSSPKDIELLLMHN
GIA10065|Rpl32       ---MAGEMIHPLPHKIIIKKRKNKFIRFQSERFVRVKPS-WRKPRGIDSPMRHQYRGQRPMVSIGYGSDKETRFMLP--CGFFKHRISTVHELKTLFMNN
HAL10052|VNG1711G    EKTPDLSEDEQRLLQKRRSVNTPQFNRQDYHKKKRTPTS-WRRPKGTLSKQRRGIKGKGDTVEAGFRTPTAVRGKHP--SGFEEVRVHNTDDLAGVDP--
MET10055|MJ0472      -------MNRLLRLRFKLKMKKPDFIRQEAHRHKRLGEK-WRRPKGRHSKMRLKWKEKPPVVEIGYRSPKAVRGLHP--SGLEDVLVYNVKDLEKLNP--


HUM10066|RPL32       KSYCAEIAHNVSSKNRKAIVERAAQLAIRVTNPNARLRSEENE---------------
DOG10065|Rpl32       KSYCAEIAHNVSSKNRKAIVERAAQLAIRVTNPNARLRSEENE---------------
MUS10065|Rpl32       KSYCAEIAHNVSSKNRKAIVERAAQLAIRVTNPNARLRSEENE---------------
RAT10065|LOC362421   KSYCAEIAHNVSSKNRKAIVERAAQLAIRVTNPNARLRSEENE---------------
CHK10067|Rpl32       KSYCAEIAHNVSSKNRKVIVERAAQLAIKITNPNARLRSEENE---------------
FUG10066|RPL32       KTHCAEIAHNVSSKKRKLIVERAAQLAIKITNPNARLRSEENE---------------
DAN10065|Rpl32       KSHCAEIAHNVSSKNRKLIVERAAQLAIKVTNPNARLRSEENE---------------
MED10065|Rpl32       KTHCAEIAHNVSSKNRKVIVERAAQLAIKITNPNARLRSEENE---------------
CIO10065|RPL32       RKFAAEIAHAVSSRKRKVIVQRAGELNIHVTNPNARLRSEENE---------------
DRO10086|RpL32       RVYCGEIAHGVSSKKRKEIVERAKQLSVRLTNPNGRLRSQENE---------------
MOS10066|Rpl32       RVYCAEIAHAVSSKKRKAIVERAKQLAIAVTNPNARLRAQEME---------------
BEE10067|Rpl32       RKFCAEIAHGVSSKKRKSIVERAQQLSIRVTNASARLRSQENE---------------
CEL10070|rpl-32      YKYIGEIGHGVSAKSRKGIVERAAQLNIKLTNGNARLRTEESE---------------
BMA10065|RPL32       KRFAGEVAHGVSSKKRKSIVERAQQLNIKLTNGHAKIRSEENE---------------
STE10065|RPL32       RSYAAEIAHNVSSRKRKAIVERAQQLSIKVTNSNARLRSEENE---------------
MBR10065|RPL32       RTYAAELAHNLSARTRRELVTRAAQLNVKLTNGGARVRSEESE---------------
NEU10066|Rpl32       KTYAAEIAHNVSSRKRIEIIARAKQLSVKVTNAKAKVTTEV-----------------
GRI10065|Rpl32       QVFAAEIAHNVSSRKRIEIIARAKQLGVKVTNPKAKVTTEV-----------------
GRA10066|Rpl32       KTHAAEIAHNVSSRKRVDIIARAKQLGVKVTNPKAKVTTEV-----------------
STA10065|Rpl32       TTFAAEIAHSVSARKRIDIVARAKQLGVKVTNGKARVKTES-----------------
YAR10066|Rpl32       KVFAAEIAHNVSSRKRLAILERAKALGVKVTNPAGRLSLQA-----------------
POM10115|RPL32-1     KTYAAEIASNVSARKRVEIVEKARALGVKVTNAGAKVRSQE-----------------
POM10116|RPL32-2     KTYAAEIAGNVSARKRVEIVEKARALGVKVTNAGAKVRSQE-----------------
YST10113|RPL32       KTYAAEIAHNISAKNRVVILARAKALGIKVTNPKGRLALEA-----------------
CIN10066|RPL32       KTFAAEIAHNVSSRNRTAILDRAKVLSIKVTNPTARLRSEE-----------------
NEA10065|Rpl32       GKYAASIAHGVSSKKRVEIIARAKVLGVKVTNPAAKLRTEEA----------------
MAY10065|Rpl32       GVYAAEIAHNVSSKKRIDILEKAKALGVKVTNANARVRAQEA----------------
RHI10249|Rpl32       RSYAAEIAHNVSSKKRVALLERAAQLNVKVINAGARLRSQE-----------------
RHI10250|Rpl32-2     RSYAAEIAHNVSSKKRVALLERAAQLNVKVINAGARLRSQE-----------------
RHI10251|Rpl32-3     RSYAAEIAHNVSSKKRVALLERAAQLNVKVINAGARLRSQE-----------------
RHI10252|Rpl32-4     RSYAAEIAHNVSSKKRVALLERAAQLNVKVINAGARLRSQE-----------------
RHI10253|Rpl32-5     RSYAAEIAHNVSSKKRVALLERAAQLNVKVINAGARLRSQE-----------------
ARA10180|RPL32A      RTYCAEIAHNVSTKKRKAIVERASQLDVVVTNRLARLRSQEDE---------------
ARA10181|RPL32B      RTYCAEIAHNISTKKRKAIVERASQLDVVVSNKLGRLRSQEDE---------------
RIC10215|RPL32A      RTYCAEIAHNVSTKKRKEIVERAAQLDIVVTNKLARLRSQEDE---------------
RIC10216|RPL32B      RMYCAEIAHNVSTKKRKEIVERAAQLDIVVTNKLARLRSQEDE---------------
RIC10217|RPL32A      RTYCAEIAHNVSTKKRKEIVERAAQLDIVVTNKLARLRSQEDE---------------
GMA10332|LOC10080318 RTYCAEIAHNISTRKRKDIVERAAQLDVVVTNKTARLRSQEDE---------------
GMA10333|LOC10049994 RTYCAEIAHNISTRKRKDIVERAAQLDVVVTNKTARLRSQEDE---------------
GMA10334|LOC10052777 RTYCAEIAHNISTRKRKDIVERAAQLDVVVTNKTARLRTQEDE---------------
GMA10335|LOC10080318 RTYCAEIAHNISTRKRKDIVERAAQLDVVVTNKTARLRSQEDE---------------
GMA10336|LOC10030640 RTYCAEIAHNVSTRKRKDIVERAAQLDVVLTNKTARLRSQEDE---------------
GMA10337|LOC10049984 RTYCAEIAHNVSTRKRKDIVERAAQLDVVLTNKTARLRSQEDE---------------
GMA10338|LOC10078756 RTYCAEIAHNISTRKRKDIVERAAQLDVVVTNKTARLRSQEDE---------------
POP10066|RPL32       RTYCAEIAHNVSTRKRKEIVERAAQLDVVVTNKLARLRSQEDE---------------
CRE10065|RPL32       RRFCAEIAHNVAVLKRKAIVERAAQLNIRVINGAARLRSQEDE---------------
VOL10070|RPL32       RRFCAEIAHSVAVLKRKAIVERAAQLNIRVINGNARLRSQEDE---------------
HEM10059|rpl32       KKISIEISKRISSFKKKKIVDLALIMDIKINNPLILKKGD------------------
PTR10067|RPL32       RTYAATVAHSVSSRIRREIVERAEQLAIRVTNANAKLRAEEDA---------------
TPS10066|Rpl32       RTYAATVGKSVSSRVRREIVERAEQLAVRVTNAAAKLRAEEDA---------------
CYA10066|RPL32       RRYCAVIAHSVSARKRAAIVKRAAALDIRVANALGRLEPVES----------------
DIC10065|RPL32       RRYAAVIFHGVSAKSRKAIVERAAELNIKVTTPNARLRSEERE---------------
PLA10072|RPL32       TKYCVQIAHNVSSKKRKQIIERAKQMNVSVINAKARLQKTEE----------------
TGO10065|RPL32       TKFAAEIAHNISSRKRREILERADQLNVLVLNRSARLDTAEDE---------------
GIA10065|Rpl32       KTHAAQIAHGVSARSRKQILEEAKKMGVRVLNADAKLRKEEL----------------
HAL10052|VNG1711G    DTEAARIASKVGARKRERIEEHAESQGIRVLNPTYVEVEVEDNE--------------
MET10055|MJ0472      ETQGARIASTVGKRKKIEIIIRARELGIRILNISEEKQEELLKLAEKQEAQEVNETNE