CLUSTAL W (2.1) Multiple Sequence Alignments
HUM10069|RPL35A      ---------------------------------------------------------------------------MSGRLWSKAIFAGYKRGLRNQREHT
DOG10068|Rpl35a      ---------------------------------------------------------------------------MSGRLWSKAIFAGYKRGLRNQREHT
MUS10068|Rpl35a      ---------------------------------------------------------------------------MSGRLWCKAIFAGYKRGLRNQREHT
RAT10068|Rpl35a      ---------------------------------------------------------------------------MSGRLWCKAIFAGYKRGLRNQREHT
CHK10070|Rpl35a      ---------------------------------------------------------------------------MSGRLWCKATFAGYKRGLRNQREHT
FUG10069|RPL35A      ---------------------------------------------------------------------------MPGRLWSKAIFAGYKRGLRNQREHT
DAN10068|Rpl35a      ---------------------------------------------------------------------------MPGRLWSKAIFAGYKRGLRNQREHT
MED10068|Rpl35a      ---------------------------------------------------------------------------MPGRLWSKAIFTGYKRGLRNQREHT
CIO10068|RPL35A      ---------------------------------------------------------------------------MADRLWCKAVFTGYTRGLRNQHEHT
DRO10089|RpL35A      ------------------------------MADTQAKSTTAPKAAKAQKAPKAVKAPKAEKPAASEAKVSAKKYKRHGRLFAKAVFTGYKRGLRNQHENQ
MOS10069|Rpl35a      MADTATAAAATKKPAKKAAPKKAAAKAEAGAKADAAKAAPKGDRKSRQTPEAIRARVKRAKELRTPKPNLPRPKKSFGRLWAKAVFTGYKRGLRNQHEKH
BEE10070|Rpl35a      ------------------------------MADTPAEPKSKTKATKKPKEKPVEPPPLKKR-----------PFKRHGRLYAKAIFTGYKRGLRNQHEHT
CEL10073|rpl-33      --------------------------------------------------------------MADTAVARRPSAPTTGRLYVKAIFTGFKRGLRTQSEHT
BMA10068|RPL35A      --------------------------------------------------------------MSEDQTVRQQGPKPAGRLYVKAVFVGYKRSQRNQREHT
STE10068|RPL35A      -------------------------------------------------------------------------MSQPVRLYTKGIVLGFKRGLRNQHPNT
MBR10068|RPL35A      --------------------------------------------------------------------MTPFKSYPKCRLFAKAKFVGFRRSRKNQQVGT
NEU10069|Rpl35a      -----------------------------------------------------------------------MPTEAGHRLYVKGRHLSYQRGRHTTHPKT
GRI10068|Rpl35a      -----------------------------------------------------------------------MPTEAGHRFCRG-RHLSYQRSRHTNRPET
GRA10069|Rpl35a      -----------------------------------------------------------------------MPSEAGHRLYVKGRHLSYQRSRHTTRPAT
STA10068|Rpl35a      ------------------------------------------------------------------------MSEKSHRLYVKGKHISYQRGKRNTNPGT
YAR10069|Rpl35A-1    -------------------------------------------------------------------------MANSTRLYVKGKHISYQRSKRVVNPNV
YAR10070|Rpl35A-2    -------------------------------------------------------------------------MTSSTRLYVKGKHLSYQRSKRVVNPNV
POM10120|RPL35A      ------------------------------------------------------------------------MPAQGHRLYVKAKHLSFQRSKHVIHPGT
POM10121|RPL35A-1    ------------------------------------------------------------------------MPAQGHRLYVKAKHLSFQRSKHVIHPGT
YST10118|RPL33A      -------------------------------------------------------------------------MAESHRLYVKGKHLSYQRSKRVNNPNV
YST10119|RPL33B      -------------------------------------------------------------------------MAESHRLYVKGKHLSYQRSKRVNNPNV
CIN10069|RPL35A      --------------------------------------------------------------------------MGSTRLYSKGRVLGHKRGKRNTRPNT
NEA10068|Rpl35a      ---------------------------------------------------------------------------MSNRLYIKGRILGHKRGKRNSRPNQ
MAY10068|Rpl35a      ----------------------------------------------------------------------MASEHSHSRLYVKGRIMGHKRSQRVAKCHT
RHI10262|Rpl35A      --------------------------------------------------------------------------MGSDRLYSKGRVLGYERAKRNQNPNV
RHI10263|Rpl35A-2    --------------------------------------------------------------------------MGSDRLYSKGRVLGYERAKRNQNPNV
RHI10264|Rpl35A-3    ---------------------------------------------------------------------------MSDRLYSKGRVLGYERAKRNQNPNV
RHI10265|Rpl35A-4    ---------------------------------------------------------------------------MSDRLYSKGRVLGYERAKRNQNPNV
ARA10189|RPL35Aa     --------------------------------------------------------------------MVKGRQGERVRLYVRGTILGYKRSKSNQYPNT
ARA10190|RPL35Ab     ---------------------------------------------------------------------MKGRQGERVRLYVRGTVLGYKRSKSNQYPNT
ARA10191|RPL35Ac     --------------------------------------------------------------------MVKGRQGERVRLYVRGTILGYKRSKSNQYPNT
ARA10192|RPL35Ad     ---------------------------------------------------------------------MKGRQGERVRLYVRGTVLGYKRSKSNQYPNT
RIC10225|RPL35Ab     ---------------------------------------------------------------------MKGRQGQRVRLYVRGTILGYKRSKSNQYENT
RIC10226|RPL35Ac     ---------------------------------------------------------------------MKGRQGQRVRLYVRGTILGYKRSKSNQYENT
GMA10350|LOC10030595 --------------------------------------------------------------------MVKGRQGERVRLYVRGTILGYKRSKSNQYPNT
GMA10351|LOC10080046 --------------------------------------------------------------------MVKGRQGERVRLYVRGTILGYKRSKSNQYPNT
GMA10352|LOC10030599 --------------------------------------------------------------------MVKGRQGERVRLYVRGSILGYKRSKSNQYPNT
GMA10353|LOC10049974 --------------------------------------------------------------------MVKGRQGERVRLYVRGSILGYKRSKSNQYPST
POP10069|RPL35A      --------------------------------------------------------------------MVKGRQGERVRLYVRGTILGYKRSKSNQYPNT
CRE10068|RPL35A      ------------------------------------------------------------------------MGGENVRLFVKGHILGYKRSKANQQNHT
VOL10073|RPL35A      ------------------------------------------------------------------------MGGENVRLYVKGHILGYKRSKANQQNHT
HEM10061|rpl35A      --------------------------------------------------------------------MEIDTKGRERRNFAKATIVGFKRGLRQQKIKD
PTR10070|RPL35A      ----------------------------------------------------------------------MAGEKRAPRLHVDGAILGYKRGLRNQHNSV
TPS10069|Rpl35a      ---------------------------------------------------------------------MTKQGTQPVRLYTNGAILGYKRGLRTQHNHT
CYA10069|RPL35A      ------------------------------------------------------------------------MGQQPVRVYCKGVILGYRRSQRRQYPNQ
DIC10068|RPL35A      ----------------------------------------------------------------------------MEKIYSKGVVLGYRRSQATQYPNI
PLA10075|RPL35A      ----------------------------------------MENVKVKKEQTEVSQKKKVVKKVLKKNKKTSNKKLQAVRLYEKGVILGYKRSQRNQDPNF
TGO10068|RPL35A      --------------------------------------------------------------------MKKSGTKQPVRLYVRGIVLGYKRSKVNQYPSC
GIA10068|Rpl35a      ------------------------------------------------------------------------MEEIKGKTFLPAIFVGYQRSRAKQRENV
PYR10053|PHS052      -------------------------------------------------------------------------------MRIKGVVLSYRRSKENQHTNV


HUM10069|RPL35A      ALLKIEGVYARDETEFYLGKRCAYVYKAKNNTVTPG--GKPNKTRVIWGKVTRAHGNSGMVRAKFRSNLPAKAIGHRIRVMLYPSRI-------------
DOG10068|Rpl35a      ALLKIEGVYARDETEFYLGKRCAYVYKAKNNTVTPG--GKPNKTRVIWGKVTRAHGNSGMVRAKFRSNLPAKAIGHRIRVMLYPSRI-------------
MUS10068|Rpl35a      ALLKIEGVYARDETEFYLGKRCAYVYKAKNNTVTPG--GKPNKTRVIWGKVTRAHGNSGMVRAKFRSNLPAKAIGHRIRVMLYPSRI-------------
RAT10068|Rpl35a      ALLKIEGVYARDETEFYLGKRCAYVYKAKNNTVTPG--GKPNKTRVIWGKVTRAHGNSGMVRAKFRSNLPAKAIGHRIRVMLYPSRI-------------
CHK10070|Rpl35a      ALLKIEGVYARQETEFYLGKRCAYVYKAKNNTVTPG--GKPNRTRVIWGKVTRAHGNSGMVRAKFRSNLPAKAIGHRIRVMLYPSRI-------------
FUG10069|RPL35A      ALLKVEGCYTRDEVDFYLGKRCAYVYKAKKNTVTPG--GKPNKTRVIWGKVTRAHGSSGMVRAKFSSNLPAKAMGHRIRVMLYPSRV-------------
DAN10068|Rpl35a      ALLKLEGVYNRGEVDFYLGKRCAYVYKAKKKTATPG--GKPNKTRVIWGKVTRAHGNSGMVRAKFKSNLPAKAIGHRIRVMLYPSRV-------------
MED10068|Rpl35a      ALLKLEGCYSRDQVDFYLGKRCAYVYKAKKNTVTPG--GKPNKTRVIWGKVTRAHGNSGMVRAKFSSNLPAKAIGHRIRVMLYPSRV-------------
CIO10068|RPL35A      ALLRIEGVTNKEDTDFYLGKKCAYVYKAKRKTKTPR--GEPNKTRVIWGKVTRSHGNSGVVRATFKTNLPAKAIGHRIRVMMYPSRI-------------
DRO10089|RpL35A      AILKIEGARRKEHGSFYVGKRCVYVYKAETKKCVPQHPERKTRVRAVWGKVTRIHGNTGAVRARFNRNLPGHAMGHRIRIMLYPSRI-------------
MOS10069|Rpl35a      ALLKIEGCRNRKNVLFYIGKRCVYVYRGKSKQNHPGS-NKKSTIRAIWGKITRSHGNSGSVRARFRTNLPGHAMGHRIRIMLYPSRI-------------
BEE10070|Rpl35a      ALLKVEGARDKQDSNFYVGKRCVYVYKAKNKTPVPGKKSRKTKVRAIWGKVTRPHGTSGSVRAKFKKNLPAKAMGHRIRIMLYPSRI-------------
CEL10073|rpl-33      SLLKLEGVFNKEDAGFYAGKRVVYLYKAHNKTLKTG-HTVATRTRAIWGKITRPHGNAGAVRAKFHHNIPPSALGKRIRVLLYPSNI-------------
BMA10068|RPL35A      SLLKLEGVYNKQDAQWYVGKRVLYVYKAHKKTRVHG-KTPS-RVRAIWGRITRVHGNAGTVKAKFRRNLPPQAMGKRVRVMLYPSNI-------------
STE10068|RPL35A      SLVKIEGVDERKNTEFYLGKRLAFVYRAKNKTVAKGD-KKATKLRVIWGKVTRAHGNSGVVRAKFRHNLPPKAMGATVRVMLYPSRV-------------
MBR10068|RPL35A      SLLNIEGCHNPEDAKFYLGKRVAYVYKGQKADKKGS------TTRVIWGKVTRTHGNSGAVRAQFKSNLPPSAIASQVRVMLYPSHI-------------
NEU10069|Rpl35a      SLIKIEGVDDTAAANFYLGKRVAYVYRGQKEVRGTKI-R------VIWGKVTRPHGNSGVVRAKFAAPLPSRSFGASVRIMLYPSSI-------------
GRI10068|Rpl35a      SLIKIEGVDDTNAANFYLGKKVAYVYRAQKEVRGTKI-R------VIWGKVTRPHGNSGVVRAKFTTPLPTRSFGASVRIMLYPSSI-------------
GRA10069|Rpl35a      SLIKIEGVDDTNAANFYLGKKVAFVYRAQKEIRGTKI-R------VIWGKVTRPHGNSGVVRAKFTSPLPTKSFGASVRVMLYPSSI-------------
STA10068|Rpl35a      SLLKLEGVDNTEAANWYCGKRVAYVYRAQRAIQGSKI-R------VIWGKVTRPHGNSGAVRAKFRSNLPPKSFGASVRVMLYPSSI-------------
YAR10069|Rpl35A-1    SLVKIEGVSNPDEAKFYVGKRVAYVYRAEKEIRGSKV-R------VMWGKISRTHGNSGVVRARFRHNLPAKTFGSSVRIMLYPSNI-------------
YAR10070|Rpl35A-2    SLVKIEGVSNPEEAKFYLGKRVAYVYRADKEIRGTKV-R------VIWGKIVRTHGNSGAVRARFRHNLPAKTFGSSLRIMLYPSNI-------------
POM10120|RPL35A      SIVKIEGCDSKEEAQFYLGKRVCYVYKSSKAVRGSKI-R------VIWGTIARPHGNSGAVRARFVHNLPAKTFGSSLRVMLYPSNI-------------
POM10121|RPL35A-1    SLVKIEGCDSKEEAQFYLGKRICFVYKSNKPVRGSKI-R------VIWGTVSRPHGNSGVVRARFTHNLPPKTFGASLRVMLYPSNV-------------
YST10118|RPL33A      SLIKIEGVATPQDAQFYLGKRIAYVYRASKEVRGSKI-R------VMWGKVTRTHGNSGVVRATFRNNLPAKTFGASVRIFLYPSNI-------------
YST10119|RPL33B      SLIKIEGVATPQEAQFYLGKRIAYVYRASKEVRGSKI-R------VMWGKVTRTHGNSGVVRATFRNNLPAKTFGASVRIFLYPSNI-------------
CIN10069|RPL35A      SLIQIEGVASKEDAQFYLGKRVAYVYKAKREIQGSKI-R------VIWGRVTRPHGSSGVVKSKFRSNLPPHAFGASVRVMLYPSNI-------------
NEA10068|Rpl35a      SLLQIEGVDNKEAATHYLGKRVAYVYKAKREINGSRV-R------VIWGRISRSHGNSGAVKSKFRTNLPAKTFGASCRIMLFPSNI-------------
MAY10068|Rpl35a      SLIKIEGVEKTDEAKFYLGKRVAYVYKATKEVRGSKI-R------VIWGRITRPHGNSGVVRAKFAHNIPPQAFAARVRIMLYPSSI-------------
RHI10262|Rpl35A      SLIQVEGVQTTKDAQFYLGKRVAYVYRAQREINGSKI-R------VIWGRIARTHGTNGVVKARFRKNLPPKVFGASVRVMLYPSNI-------------
RHI10263|Rpl35A-2    SLIQVEGVQTTKDAQFYLGKRVAYVYRAQREINGSKI-R------VIWGRIARTHGTNGVVKARFRKNLPPKVFGASVRVMLYPSNI-------------
RHI10264|Rpl35A-3    SLIQVEGVQTTKDAQFYLGKRVAYVYRAQREINGSKV-R------VIWGRIARTHGTNGVVKARFRKNLPPKVFGASVRVMLYPSNI-------------
RHI10265|Rpl35A-4    SLIQVEGVQTTKDAQFYLGKRVAYVYRAQREINGSKV-R------VIWGRIARTHGTNGVVKARFRKNLPPKVFGASVRVMLYPSNI-------------
ARA10189|RPL35Aa     SLVQVEGVNTTEEVSWYKGKRMAYIYKAKTKKNGSH-------YRCIWGKVTRPHGNSGVVRAKFTSNLPPKSMGSRVRVFMYPSNI-------------
ARA10190|RPL35Ab     SLIQIEGVNTQEEVNWYKGKRLAYIYKAKTKKNGSH-------YRCIWGKVTRPHGNSGVVRSKFTSNLPPKSMGARVRVFMYPSNI-------------
ARA10191|RPL35Ac     SLVQIEGVNTQEEVNWYKGKRMAYIYKAKTKKNGSH-------YRCIWGKVTRPHGNSGVVRAKFTSNLPPKSMGSRVRVFMYPSNI-------------
ARA10192|RPL35Ad     SLVQIEGVNTQEEVNWYKGKRLAYIYKAKTKKNGSH-------YRCIWGKVTRPHGNSGVVRSKFTSNLPPKSMGARVRVFMYPSNI-------------
RIC10225|RPL35Ab     SLLQIEGVNTKEEVGWYAGKRIAYVYKAKTKSNDST-------IRCIWGKVTRPHGNSGVVRAKFRSNLPPTSMGKKVRVFMYPSSI-------------
RIC10226|RPL35Ac     SLLQIEGVNTKEEVGWYAGKRIAYVYKAKTKSNDST-------IRCIWGKVTRPHGNSGVVRAKFRSNLPPTSMGKKVRVFMYPSSI-------------
GMA10350|LOC10030595 SLIQIEGVNTKEEVGWYAGKKMAYIYKAKVKKDGSH-------YRCIWGKVTRPHGNSGVVRAKFKSNLPPRSMGARVRVFMYPSNI-------------
GMA10351|LOC10080046 SLIQIEGVNAKEEVAWYAGKKMAYIYKAKVKKNGSH-------YRCIWGKVTRPHGNSGIVRAKFKSNLPPKSMGARVRVFMYPSNI-------------
GMA10352|LOC10030599 SLIQIENVNTKEEVAWYCGKRMAYIYKAKVKKDGSH-------YRCIWGKVTRPHGNSGIVRAKFKSNLPPRSMGARVRVFMYPSNI-------------
GMA10353|LOC10049974 SLIQIENVNSKEEVAWYCGKRMAYIYKAKVKKNGSH-------YRCIWGKVTRPHGNSGIVRAKFKSNLPPRSMGARVRVFMYPSNI-------------
POP10069|RPL35A      SLVQVEGVNTKEEVAWYAGKRMAYIYKAKVKKNGSH-------YRCIWGKVTRPHGNSGVVRAKFKSNLPPKSMGARVRVFMYPSNI-------------
CRE10068|RPL35A      ALLKVDGVATKKEVAWYLGKRIAYIYKAKNEKQGTK-------FRCIWGRVMRAHGNVGVVKAKFSSNLPPISLGGAVRVMLYPSRV-------------
VOL10073|RPL35A      ALLKIDGVATKKETAWYLGKRIAYIYKAKTEKQGTK-------FRCIWGRVMRAHGNVGVVKAKFASNLPPISLGGAVRVMLYPSRV-------------
HEM10061|rpl35A      VRIKISKIKHEKESKFFLGKKVFFIPKNLNIKKRK----------VIWGKIKKLHGRSGVFIAQFKKNLPPNSISMNVNISYLPW---------------
PTR10070|RPL35A      SLIKIKGCDSKEDVDFYLGKKVAFITKAADG-----------AFRVNWGKVCRHHGGNGVVRCRFRRDLPPQSIGGRVRVMLYPSRV-------------
TPS10069|Rpl35a      SLIKIKGCDSKDSTQFYLGKRIAYITKGASGSGKNG-----SKFRVNWGKVCRAHGSNGVVRCKFARDLPPQSIGGRVRVMLYPSRV-------------
CYA10069|RPL35A      TRIQIEGVRTRDETTFYAGKRVAYVYKAKRARTTTRG-RV-TRYRCIWGRIIAPHGSSGCVRAKFATNLPPSAIGKAVRVMLYPSRV-------------
DIC10068|RPL35A      SLIKIEGVVSREDSTFYLGKKVCLVSKVSKSAKNPTG------HKISWGKICKTHGSSGVVQARFARNLPPKAMGAPVRVMLYPSNI-------------
PLA10075|RPL35A      TLISIKNVNTKKHAQFYVGKRVAYVYRTTKHHDGVKI-K------CIWGKVCRTHGNSGVIRAKFKTHIPPKAFGDRVRILMYPSNI-------------
TGO10068|RPL35A      SLLQLEGVNDRKDTQFYLGKRVAYVYKAKTEKQGSK-------YRVIWGRIRRPHGNGGIVRAKFRSNLPPSSIAGRVRVFLYPSNI-------------
GIA10068|Rpl35a      ALVKVSGIYTRAETDKVLGRLIAIIHSKSGKP--------------IFGKICRPHGNSGMVRARFYTNLPGQLMGHKVRVFYDNIDVGDRATPKYERLYG
PYR10053|PHS052      MIIKPLDINSREEASKLIGRLVVWKSP-SGKV--------------LKGKIVRVHGTRGAVRARFEKGLPGQALGDYVEII-------------------


HUM10069|RPL35A      ---------
DOG10068|Rpl35a      ---------
MUS10068|Rpl35a      ---------
RAT10068|Rpl35a      ---------
CHK10070|Rpl35a      ---------
FUG10069|RPL35A      ---------
DAN10068|Rpl35a      ---------
MED10068|Rpl35a      ---------
CIO10068|RPL35A      ---------
DRO10089|RpL35A      ---------
MOS10069|Rpl35a      ---------
BEE10070|Rpl35a      ---------
CEL10073|rpl-33      ---------
BMA10068|RPL35A      ---------
STE10068|RPL35A      ---------
MBR10068|RPL35A      ---------
NEU10069|Rpl35a      ---------
GRI10068|Rpl35a      ---------
GRA10069|Rpl35a      ---------
STA10068|Rpl35a      ---------
YAR10069|Rpl35A-1    ---------
YAR10070|Rpl35A-2    ---------
POM10120|RPL35A      ---------
POM10121|RPL35A-1    ---------
YST10118|RPL33A      ---------
YST10119|RPL33B      ---------
CIN10069|RPL35A      ---------
NEA10068|Rpl35a      ---------
MAY10068|Rpl35a      ---------
RHI10262|Rpl35A      ---------
RHI10263|Rpl35A-2    ---------
RHI10264|Rpl35A-3    ---------
RHI10265|Rpl35A-4    ---------
ARA10189|RPL35Aa     ---------
ARA10190|RPL35Ab     ---------
ARA10191|RPL35Ac     ---------
ARA10192|RPL35Ad     ---------
RIC10225|RPL35Ab     ---------
RIC10226|RPL35Ac     ---------
GMA10350|LOC10030595 ---------
GMA10351|LOC10080046 ---------
GMA10352|LOC10030599 ---------
GMA10353|LOC10049974 ---------
POP10069|RPL35A      ---------
CRE10068|RPL35A      ---------
VOL10073|RPL35A      ---------
HEM10061|rpl35A      ---------
PTR10070|RPL35A      ---------
TPS10069|Rpl35a      ---------
CYA10069|RPL35A      ---------
DIC10068|RPL35A      ---------
PLA10075|RPL35A      ---------
TGO10068|RPL35A      ---------
GIA10068|Rpl35a      NPNATVTYE
PYR10053|PHS052      ---------