CLUSTAL W (2.1) Multiple Sequence Alignments
HAL10018|VNG1689G    --MPQPNRPRKGSMGFSPRKRAESEVPRFNSWP-ADDGEVGLQGFAGYKAGMTHVVLVDDKANAPTEGMETTVPVTVVETPPMRAAAVRLYEDTPYGKKP
MET10028|MJ0176      -MGLNINRPRRGSLAFSPRKRAKRPVPRIRSWP--EEDTVRLQAFPVYKAGMSHAFIKEDNPKSPNAGQEVFTPITILEAPPINVCAIRVYGRNERNYLT
PYR10017|PH1777      --MGKIHRPRKGSLAFSPRKRAKSIVPRIRSWP--KETEVRMLGFAGYKAGMTHILMIDDEP-GLTNGKEIFMPVTIIETPPLRVFGIRAYRQGYLGLET
THE10023|TTHA1692    -----------------------------------------VKGILGVKVGMTRIFR---------DDR--AVPVTVILAGPCPVVQRRTPE--------
SYN10025|sll1799     ----------------------------------------VSIGILGTKLGMTQIFD---------QESGISIPVTVVQAGPCPVTQVKTQD--------
BAC10024|Bsu0116     ----------------------------------------MTKGILGRKIGMTQVFA---------ENG-DLIPVTVIEAAPNVVLQKKTAE--------
ECO10024|rplC        -----------------------------------------MIGLVGKKVGMTRIFT---------EDG-VSIPVTVIEVEANRVTQVKDLA--------
SUL10018|ST0429      MGHRKLASPRRGSAGVRPRKRASEILPTPRSWPTIQSNEPKLLGFVGYKVGMSHIFMIDDKPTSPNYGKEIYVPVSVIETPPVIPLAIRAYVMGPKGEPT


HAL10018|VNG1689G    LTEVWADDT--------HESLDRTLSVPDEGGD---------------TDELIEALDTEEIADIRVITHTVPGDTAGVPKKNPDVMETRVGGGTLADRLE
MET10028|MJ0176      TLTEVWADN-------LDKELERKIKLPKKEDR---------------KTVEDLEALKDKIEDVRVLVHTNPKLT-CLPKKKPEILEIRIGGKDIEERLN
PYR10017|PH1777      AGEVIVPDFELDNYTPSKKGKGRKFTFYQFLGRRIATLPKDYTQEEFEQKLGALEDMIKEGEIVEVRALVSTQPWVIKLKKKPEVMEYAIGGTSVEEKFN
THE10023|TTHA1692    ----------------------------------------------------------KDGYTAVQLGFLPQNPKRVNRPLKGHFAKAGVEPVRILREIR
SYN10025|sll1799     ----------------------------------------------------------TDGYNAIQVGFLPVKEKALSKPELGHLKKSNTDPMRHLKEYR
BAC10024|Bsu0116     ----------------------------------------------------------NDGYEAIQLGFDDKREKLSNKPEKGHVAKAETAPKRFVKELR
ECO10024|rplC        ----------------------------------------------------------NDGYRAIQVTTGAKKANRVTKPEAGHFAKAGVEAGRGLWEFR
SUL10018|ST0429      TLTEYWGDISEDLLKLIQQRKVTRLKIDKEKMK---------------GKLDEINNKLNDILYLRVLIATQPKLVPSLGKKKPEIVEVQVGGGDIKSQLN


HAL10018|VNG1689G    FAADLIEDGGVHAFGDVFRAGEFTDAAGITKGKGTQGPVKRWGVQKRKGKHARQGWRRRIGNLG-PWNPSRVRSTVPQQGQTGYHQRTELNKRLIDINDG
MET10028|MJ0176      YAKEILG--KQLNITDVFQEGELVDTIGVTKGKGFQGQVKRWGVKIQFGKHARKGVGRHVGSIG-PWQPKMVMWSVPMPGQMGYHQRTEYNKRILKIGNN
PYR10017|PH1777      YIKEKLG--KEIRVGEVLKEGELLDVIAVTKGKGTQGPVKRWGIKLR--AHKDSKGRRKVGSIG-PWHPARVMWTVPMAGQMGFHHRTELNKRLIAIGEN
THE10023|TTHA1692    DFNPE----GDTVTVEIFKPGERVDVTGTSKGRGFAGVMKRWNFAGGPDSHGAHKIHRHPGSIGNRKTPGRVYKGKKMAGHYGAERVTVMNLEVVDVIPE
SYN10025|sll1799     LTDAPNLQPGDAVTADIFQAGDLVDVAGQSMGRGFAGYQKRHNFRRGNMTHGS-KNHRLPGSTGAGTTPGRVYPGKRMAGQYGASQVTVRRLTVVRVDAE
BAC10024|Bsu0116     GVEMDAYEVGQEVKVEIFSAGEIVDVTGVSKGKGFQGAIKRHGQSRGPMSHGS-RYHRRPGSMG-PVDPNRVFKGKLLPGRMGGEQITVQNLEIVKVDAE
ECO10024|rplC        LAEGEEFTVGQSISVELFADVKKVDVTGTSKGKGFAGTVKRWNFRTQDATHGNSLSHRVPGSIGQNQTPGKVFKGKKMAGQMGNERVTVQSLDVVRVDAE
SUL10018|ST0429      YVLNILG--KPLSVKDVFKEGQLIDIIGVTKGKGFQGVVKRYGVVELPRWHKHRKGSRKVGARG-PSFS--TPSYVPQPGQMGYHRRTEYNKRILKISDD


HAL10018|VNG1689G    D---------EPTPDGGFPNYGEVDGPYTLVKGSVPGPEQRLVRFRPAVRP--NESPRLDPEVRYVSTASNQG-
MET10028|MJ0176      G--------DEITPKGGFLHYGVIRNNYVVLKGSVQGPAKRLIVLRRAIRP--QEPLIKVPEITYISTTSKQGK
PYR10017|PH1777      GKLVIDGNEIEITPKGGFPHYGIVRGDFMMIAGSVPGAIKRIIRVRPAIRPPKKKPPVQRPQITYVSVESKQ--
THE10023|TTHA1692    E-------------------------NLLLVKGAVPGPNGGLVIVRETKKAAK---------------------
SYN10025|sll1799     R-------------------------NLLIIKGALPGKPGTLLNITPAKTVGRG--------------------
BAC10024|Bsu0116     R-------------------------NLLLIKGNVPGAKKSLITVKSAVKSK----------------------
ECO10024|rplC        R-------------------------NLLLVKGAVPGATGSDLIVKPAVKA-----------------------
SUL10018|ST0429      P--------NEINPKGGFVNYGIVRNTYLIIEGSIIGAKKRPLFLRYPIRP--SWIPQSAPKITYVNLYSQQG-