CLUSTAL W (2.1) Multiple Sequence Alignments
HUM10035|RPL4        ---MACARPLISVYSEKGE-----SSGKNVTLPAVFKAPIRPDIVNFVHTNLRKNNRQPYAVSELAGHQTSAESWGTGRAVARIPRVRGGGTHRSGQGAF
DOG10034|Rpl4        ---MACARPLISVYSEKGE-----SSGKNVTLPAVFKAPIRPDIVNFVHTNLRKNNRQPYAVSELAGHQTSAESWGTGRAVARIPRVRGGGTHRSGQGAF
MUS10034|Rpl4        ---MACARPLISVYSEKGE-----SSGKNVTLPAVFKAPIRPDIVNFVHTNLRKNNRQPYAVSELAGHQTSAESWGTGRAVARIPRVRGGGTHRSGQGAF
RAT10034|Rpl4        ---MACARPLISVYSEKGE-----SSGKNVTLPAVFKAPIRPDIVNFVHTNLRKNNRQPYAVSELAGHQTSAESWGTGRAVARIPRVRGGGTHRSGQGAF
CHK10035|Rpl4        ---MACARPLISVYSEKGE-----ASGKNVTLPAVFKAPIRPDVVNFVHTNLRKNNRQPYAVSELAGHQTSAESWGTGRAVARIPRVRGGGTHRSGQGAF
FUG10035|RPL4        ---MACARPLISVYSEKGE-----STGKNVVMPAVFKAPIRPDVVNFVHTNMRKNNRQPYAVSELAGHQTSAESWGTGRAVARIPRVRGGGTHRSGQGAF
DAN10034|Rpl4        ---MACARPLISVYSEKGE-----TSGKNVVMPAVFRAPIRPDIVNFVHTNMRKNKRQPYAVSELAGHQTSAESWGTGRAVARIPRVRGGGTHRSGQGAF
MED10034|Rpl4        ---MACARPLISVYSEKGE-----SVGKNVLMPAVFKAPIRPDVVNFVHTNMRKNNRQPYAVSELAGHQTSAESWGTGRAVARIPRVRGGGTHRSGQGAF
CIO10034|RPL4        ---MACARPLVSVYSEKGV-----ASG-SITLPAVFKAPIRPDIVNFVHTNISKNHRQAYAVKSIAGEQTSAESWGTGRAVARIPRVRGGGTHRSGQAAF
DRO10046|RpL4        -MSLGNARPLVSVYTEKNEP----AKDKNICLPAVFKAPIRPDVVNEVHQLLRRNNRQAYAVSELAGHQTSAESWGTGRAVARIPRVRGGGTHRSGQGAF
MOS10034|Rpl4        -MSLTAARPLVSVYSDKNEA----VKDKGVALPAIFKAPIRPDVVNEVSQLMRRNRRQAYAVSEAAGHQTSAESWGTGRAVARIPRVRGGGTHRSGQGAY
BEE10035|Rpl4        -MSLSTARPLVTIYTDKNES----SGD-TISLPAVFKAPIRPDIVNFVHQQVSKNSRQPYCVSKEAGHQTSAESWGTGRAVARIPRVRGGGTHRSGQGAF
CEL10034|rpl-4       ----MAARPLVTVYDEKYE-----ATQSQIRLPAVFRTPIRPDLVSFIADQVRRNRRQAHAVNTKAGKQHSAESWGTGRAVARIPRVRGGGTHRSGQGAF
BMA10034|RPL4        ----MSARPLVTVYNDKSE-----PTDTQIRLPGVFRAPLRPDIVSFVHDQIRKNKRQPYAVSVEAGHQTSAESWGTGRAVARIPRVRGGGTHRSGQGAF
STE10034|RPL4        ----MAARPVITVFNENGE------SAGQTTLPAVFKAPIRPDLVNFVHSNIAKNKRQPYAVNKLAGHQTSAESWGTGRAVARIPRVRGGGTHRSGQGAF
MBR10034|RPL4        ----MASRPQVTVFSAEDG-----SAKGSTTMPAVFTAPIRTDVVHFVHTNMSKNRRQPYAVKDSAGHEHSAESWGTGRAVSRIPRVSGGGTSRSGQGAF
NEU10035|Rpl4        ----MASRPTVTIIGADGK-----ATGTTEVLPKVFGAPIRPDIVKHVHTGMAKNKRQPYSVSEKAGHQTSAESWGTGRAVARIPRVSGGGTHRAGQAAF
GRI10034|Rpl4        ----MASRPTVTIIGADGK-----ASGATHPIPNVFTAPIRPDIVQQVHKGMAKNKRQPYAVSEKAGHQTSAESWGTGRAVARIPRVSGGGTHRAGQAAF
GRA10035|Rpl4        ----MASRPTVTILGKDGA-----PTGATHAIPAVFTSPIRPDIVQQVHTGMAKNKRQPYSVSEKAGHQTSAESWGTGRAVARIPRVSGGGTHRAGQAAF
YAR10035|Rpl4        ----MSTRPQVSVHGVSGS-----DAGVTIVLPAVFKAPIRPDIVHSVWTGVAKNKRQAYAVASNAGEQTSAESWGTGRAVARIPRVGGSGTHRSGQGAF
POM10058|RPL4-2      ---MAAARPTVSIYSKDGS-----VSSETIALPFVFKAPIRPDLVRSVHTAVAKNKRQPYAVSEKAGHQTSAESWGTGRALARIPRVGGGGTHRSGQAAF
POM10059|RPL4-2      ---MAAARPTVSIYNKDGS-----VSSETLALPFVFKAPIRPDLVRSVHTAVAKNKRQPYAVSEKAGHQTSAESWGTGRALARIPRVGGGGTHRSGQAAF
YST10058|RPL4A       -----MSRPQVTVHSLTGE-----ATANALPLPAVFSAPIRPDIVHTVFTSVNKNKRQAYAVSEKAGHQTSAESWGTGRAVARIPRVGGGGTGRSGQGAF
YST10059|RPL4B       -----MSRPQVTVHSLTGE-----ATANALPLPAVFSAPIRPDIVHTVFTSVNKNKRQAYAVSEKAGHQTSAESWGTGRAVARIPRVGGGGTGRSGQGAF
CIN10034|Rpl4        ----MASRPTVNVRSVSG------EASSSLPLPAVLTAPIRLDVVQQVHKSIAKNKRQAYAVSEKAGHQTSAESWGTGRAVARIPRVGGGGTHRSGQAAF
NEA10034|Rpl4        ----MAARPTVTVWSATG------EASGSLPLPAVFTAPIRLDVVQQVHKSIAKNRRQAYAVAENAGHQTSAESWGTGRAVARIPRVGGGGTQRSGQAAF
MAY10034|Rpl4        ----MAARPTVNVRGLDG------AASGSLPLPAVFTAPIRPDVVQLVHTNVAKNKRQPYAVSTKAGHQTSAESWGTGRAVARIPRVGGGGTHRSGQAAF
RHI10129|Rpl4        ---MSAARPVINVYADSGK-----NVASTVPLPAVFKAPIRPDIVNFVHTNMAKNKRQPHSVSSKAGEQTSAESWGTGRAVARIPRVNGSGTHRAGQAAF
RHI10130|Rpl4-2      ---MSAARPVINVYADSGK-----NVASTVPLPAVFKAPIRPDIVNFVHTNMAKNKRQPHSVSAKAGEQTSAESWGTGRAVARIPRVNGSGTHRAGQAAF
RHI10131|Rpl4-3      ---MSAARPVINVYADSGK-----NVASTVPLPAVFKAPIRPDIVNFVHTNMAKNKRQPHSVSSKAGEQTSAESWGTGRAVARIPRVNGSGTHRAGQAAF
ARA10095|At3g09630   -MAAAAARPLVTIQTLDGD--MSTDQSSTVVLPDVMTAPVRPDIVNFVHAQISNNSRQPYAVSKKAGHQTSAESWGTGRAVSRIPRVPGGGTHRAGQAAF
ARA10096|RPL4D       MVASAAARPLVTVQGLDGD--MSTDQSTTVTLPDVMTAPVRPDIVNFVHAQISNNSRQPYAVSKKAGHQTSAESWGTGRAVSRIPRVPGGGTHRAGQAAF
RIC10108|11673.m0076 --MATQTRPLVSVKALEGD--MATDNSSSLALAEVFRAPLRPDVVRFVHRLLSCNKRQPYAVSRRAGHQTSAESWGTGRAVSRIPRVPGGGTHRAGQGAF
RIC10109|RPL4D       --MAAAARPLVSVKALEGD--MATDSAG-IQMPQVLRAPIRPDVVTFTHKLLSCNRRQPYAVSRRAGHQTSAESWGTGRAVSRIPRVPGGGTHRAGQGAF
GMA10170|LOC10077976 --MAAAARPLVTVQALDGD--MATDASATVPIPDVMKASIRPDIVNFVHSNISKNSRQPYAVSRRAGHQTSAESWGTGRAVSRIPRVPGGGTHRAGQGAF
GMA10171|LOC10079671 --MAAAARPLVSVQTLEGD------AAPTVPLPDVMKASIRPDIVNFVHSNISRNSRQPYAVSKRAGHQTSAESWGTGRAVSRIPRVPGGGTHRAGQGAF
GMA10172|LOC10078682 --MAAAARPLVTVQALDSD--MATDASATVPIPDVMKSSIRPDIVNFVHSNISKNSRQPYAVSRRAGHQTSAESWGTGRAVSRIPRVPGGGTHRAGQGAF
GMA10173|LOC10081963 -MAVAAARPIVSVQTLEGD------ATPTVPLPDVMKASIRPDIVNFVHSNISRNSRQPYAVSKRAGHQTSAESWGTGRAVSRIPRVPGGGTHRAGQGTF
POP10034|RPL4        --MAAAARPLVSVQTLPCLNDMVTDSAATVALPDVMKASIRPDIVNYVHSNISKNSRQPYAVSKKAGHQTSAESWGTGRAVSRIPRVPGGGTHRAGQGAY
CRE10034|RPL4        ---MAAAIPMVEVHSIETG-----EKAAQVALPAVFTAPIRPDIVRTIHTNMAKNKRQAYAVFMKAGHQTAAESWGTGRAVSRIPRVPGGGTHRAGQGAF
VOL10037|RPL4        ---MAAARPLVSVINIETG-----EAAEQTALPAVFTAPIRPDIVRTIHTNMAKNKRQAYAVFMKAGHQTAAESWGTGRAVSRIPRVPGGGTHRAGQGAF
HEM10031|rpl1        -----MENWKVNVYSSEDK-----FLVDSVNLPEIFLSPIRIDIFKFVFLNMSKNKRQSYSVNQSSGMNTSAISWGTGRAVARIPRVKGSGTNRSGQGAV
PTR10036|RPL4        ----MAARPLVSVFSLSGD------KSGDVSLPAVMTAPLRPDIVQFVHTNMNKNHRQAYAVNIRAGKQVVASSWGTGRAVARIPRVGGGGTSRSGQGAF
TPS10034|Rpl4        ----MAARPLVSVFSLTGE------KAGETTLPEVMTAPMRTDIVQFVHTNMNKNNRQAYAVNVHAGKLVSAESWGTGRAVARIPRVGGGGTSRSGQGAF
CYA10035|RPL4        --MAYASRPLVSVISTKTG----ESIGEQVKLPQVFLAPIRPDVVQIVHTGVAKNARQPYGVSRMAGEWATAHSWGTGRAVSRAPRVHGGGTHRSGQVSG
DIC10034|RPL4        ----MTTRPFVQVFDAQNK------VVGKVKLPNVLTTPIRPDLVNFVHTNLNKNARQAYGAAPYAGEQTSAESWGTGRAVARIPRVPGSGTHRSGQGAF
PLA10038|RPL4        ---MATIRPVANVYSTNGK-----NVVGEVEIPVVFQTPIRNDLIQSVYTNMSKNRRHPYAVKLGAGYETSAESWGTGRAVARIPRVPGGGTHRAGQGAF
TGO10034|RPL4        ---MATARPLVSVYKPEDG-----TASGTSLMPSVFLSPLRPDLVRFVHTNMAKNRRQPYGVAPNAGYQTSAESWGTGRAVSRIPRVPGGGTHRAGQAAF
GIA10034|Rpl4        ------MNPTVKVFGPTG------TQVAELPRPKVFNVPLRPDIINFVHTQLRKCLRTPYAVSRYAGVQCTAHSWGPGRAVARLPRKHG------GIGAY


HUM10035|RPL4        GNMCRGGRMFAPTKTWRRWHRRVNTTQKRYAICSALAASALPALVMSKGHRIEEVPELPLVVEDKVEG---YKKTKEAVLLLKKLKAWNDIKKV-YASQR
DOG10034|Rpl4        GNMCRGGRMFAPTKTWRRWHRRVNTTQKRYAICSALAASALPALVMSKGHRIEEVPELPLVVEDKVEG---YKKTKEAVLLLKKLKAWNDIKKV-YASQR
MUS10034|Rpl4        GNMCRGGRMFAPTKTWRRWHRRVNTTQKRYAICSALAASALPALVMSKGHRIEEVPELPLVVEDKVEG---YKKTKEAVQLLKKLKAWNDIKKV-YASQR
RAT10034|Rpl4        GNMCRGGRMFAPTKTWRRWHRRVNTTQKRYAICSALAASALPALVMSKGHRVEEVPELPLVVEDKVES---YKKTKEAVQLLKKLKAWNDIKKV-YASQR
CHK10035|Rpl4        GNMCRGGRMFAPTKTWRRWHRRVNVTQKRYAICSALAASALPALVMSKGHRIEEIPELPLVVEDKVES---YKKTKEAVLLLKKLKAWNDIKKV-YASQR
FUG10035|RPL4        GNMCRGGRMFAPTKTWRRWHRRINTTQKRYAICSAVAASAIPALVMSKGHRIEEIPEVPLVVEDKVEG---YKKTKEAVLLLKKLKAWNDIKKV-YASQR
DAN10034|Rpl4        GNMCRGGRMFAPTKTWRRWHRRVNVNQKRYAMCSALAASALPSLVMAKGHRIEEIPEVPLVVDDKVEG---YKKTKEAVLLLKKLKAWNDIKKV-YASQR
MED10034|Rpl4        GNMCRGGRMFAPTKTWRRWHRRINTPQKRYAICSALAASAIPALVMSKGHRIEEIPEVPLVVEDKVEG---YKKTKEAVLLLKKLKAWNDIKKV-YASQR
CIO10034|RPL4        GNMCRGGRMYAPTKTWRRWHRRCNINQRRFAVCSALAASSLPALVMSKGHKIDQTPEIPLVVEDKVQQ---FKKTKDAVVLLKKLKAWDDIKKV-MKSRK
DRO10046|RpL4        GNMCRGGRMFAPTKTFRRWHRKVNVNQRRYALVSAIAASGVPALVQSKGHVIDGVSEFPLVVSDEVQK---VQKTKQAVIFLRRLKIWADIQKV-YKSQR
MOS10034|Rpl4        GNMCRGGRMFAPTKPWRRWHRKININLKRYALVSALAASGVPALVQSRGHIIDGISELPLVVSDDIQK---FQKTKQAVTFLRRSKVWADVQKV-YKSQR
BEE10035|Rpl4        GNMCRGGRMFAPTKPWRRWHRRINVNQKRYAMVSAIAASGVPALVQSKGHMVQEIPELPLVVSDKIQE---YNKTKQAVIFLRRIKAWNDIQKV-YKSQR
CEL10034|rpl-4       GNMCRGGHMFAPLKVFRRWHRNVNIAQKRYAVSSAIAASGIPALLQARGHVIDQVAEVPLVVSDKVES---FRKTKEAVVFLRRSHLWADIEKV-YNSKR
BMA10034|RPL4        GNMCRGGRMFAPTKVFRRWHRRVNVAQKRYAMVSAIAASGIPALVQARGHIIDQIPEVPFVVVDKVES---FKKTKEAVSFLRRSHFWADIEKV-YNSKR
STE10034|RPL4        GNMCRGGRMFAPTKTWRKWHTKVNVQQRRFAVCSALAASALPALIMARGHRIEKIAEVPLVISDAIES---VTKTSAAVKLLKAVNAYEDVEKC-IDSKK
MBR10034|RPL4        GNMCRKGRMFAPTKVWRHWNRRINKNQRRYATASALAASALPALVEARGHRIGDLPQVPLVIESSVET---FQKTAKAVELLKAVGAFEDVERS-RESRK
NEU10035|Rpl4        GNMCRSGRMFAPTKIWRKWHVKVNQGQKRFATASALAASAAAPLLMARGHQVSTVPEVPLVVDSAAFS--GVNKTANALALLKAVGAGADVQKA-KASKK
GRI10034|Rpl4        GNMCRSGRMFAPTKVWRKWHIKVNQGQKRFATTSALAASAVAPLLLARGHRISNIPEVPLVIDSAAFSGAALAKTAAAVGLLNAVGAGADLDKV-KKSRA
GRA10035|Rpl4        GNMCRSGRMFAPTKIWRRWHIKVAVGQKRYAVCSALAASAAVPLLQARGHQVNSVPEVPLVIDSAVFEAAAIAKTSAALGLLKAVGAGEDVSKV-KNSKK
YAR10035|Rpl4        GNMCRGGRMFAPTKTWRKWHVKVNLNEKRYATASAIAASAVAPLVLARGHRVETIAEVPLVVSNDIES---LTKTKDAVAALKAVGAHRDVARV-VKSKT
POM10058|RPL4-2      GNMCRSGRMFAPTKTWRKWHVKVNQNEKRYAISSAVAASGVPSLLLARGHRIEEIPEVPLVVDDAVQS---FQKTKEAVALLKEIKAYRDVVKV-ANSRK
POM10059|RPL4-2      GNMCRSGRMFAPTKTWRKWHVKVNQNEKRYAIASAVAASGVPSLLLARGHRIEEIPEVPLVVDDAVQS---FQKTKEAVALLKEIKAYRDVIKV-ANSRK
YST10058|RPL4A       GNMCRGGRMFAPTKTWRKWNVKVNHNEKRYATASAIAATAVASLVLARGHRVEKIPEIPLVVSTDLES---IQKTKEAVAALKAVGAHSDLLKV-LKSKK
YST10059|RPL4B       GNMCRGGRMFAPTKTWRKWNVKVNHNEKRYATASAIAATAVASLVLARGHRVEKIPEIPLVVSTDLES---IQKTKEAVAALKAVGAHSDLLKV-LKSKK
CIN10034|Rpl4        GNMCRGGRMFAPTKTWRKWHVKVNQNQRRFAVVSALAASALPSLVLARGHRIEQIEEVPLVVSSEVEA---FTKTKQAVALLQALKAHADVVKV-SNSRK
NEA10034|Rpl4        GNMCRGGRMFAPTKTWRKWHVKVNQNQRRYAVASALAASALPSLVLARGHRIEQIQEVPLVLSSSVES---TEKTKAAVELLKTVAAYPDISKV-SNSRK
MAY10034|Rpl4        GNMVRGGHMFAPTKLWRRWFIKTNQNQKRYATASALAATAVPSLVLARGHRVEELEEIPLVVADAAES---LTKTKEAIALLKSVNAYNDVVKV-SNSRK
RHI10129|Rpl4        GNMCRGGRMFAPTKTWRKWQIKTNLNQKRFATVSALAASALPSLVMARGHRVEKIEEVPLVVDDSIEK---LTKTKEAVALLKAVNAYSDVVKV-SNSRK
RHI10130|Rpl4-2      GNMCRGGRMFAPTKTWRKWQIKTNLNQKRFATASALAASALPSLVMARGHRIEKIEEVPLVVDDSAEK---VAKTKEAVALLKALNAYSDVVKV-SNSRK
RHI10131|Rpl4-3      GNMCRGGRMFAPTKTWRKWQIKTNLNQKRFATASALAASALPSLVMARGHRIEKIEEVPLVIDDSAEK---LAKTKEAVALLKAINAYSDVVKV-SNSRK
ARA10095|At3g09630   GNMCRGGRMFAPTKIWRRWHRRVNVNMKRHAIVSAIAATAVPALVMARGHKIENVPEMPLVVSDSAEA---VEKTSAAIKVLKQIGAYDDAEKA-KNSIG
ARA10096|RPL4D       GNMCRGGRMFAPTKIWRRWHRRVNVNMKRHAIVSAIAATAVPALVMARGHKIENVPEMPLVVSDSAEA---VEKTSAAIKVLKQIGAYDDAEKA-KNSIG
RIC10108|11673.m0076 GNMCRGGRMFAPTKTWRKWHRRVNVHLRRVAVASALAATSVPSLVLARGHRIETVPELPLVISDSAES---IEKTSQAIKILKQVGAYADAEKA-KDSVG
RIC10109|RPL4D       GNMCRGGRMFAPTKIWRRWHRRVNIRLRRIAVASALAATAVPSLVLARGHRIEGVPEFPLVVSDSIES---IEKTAQSIKVLKQIGAYADAEKT-KDSVA
GMA10170|LOC10077976 GNMCRGGRMFAPTKIWRRWHRKINVNQKRYAVVSAIAASAIPSLVLARGHRIESVPELPLVVSDSAEG---VEKTKEAIKVLKQIGAFPDAEKA-KDSRS
GMA10171|LOC10079671 GNMCRGGRMFAPTKIWRRWHRKINVQQKRHAVVSAIAASAIPSLVQARGHRIESVPELPLVVSDTVES---VEKSKEAVKILQKIGAFPDAEKA-KLSHG
GMA10172|LOC10078682 GNMCRGGRMFAPTKIWRRWHRKINVNQKRYAVVSAIAASAIPSLVLARGHRIESVPELPLVVSDSAES---VEKTKEAIKVLKQIGAFPDAEKA-KDSRS
GMA10173|LOC10081963 GNMCRGGRMFAPTKIWRRWHRKINVQQKRHAVVSAIAASAIPSLVQARGHRIESVPELPLVVSDTVES---VEKSKEAVKILQKIGAFTDAEKA-KLSHG
POP10034|RPL4        GNMCRGGRMFAPTKIWRRWHRKINVNQKRYAVVSAIAASAIPSLVMARGHRVESVPEMPLIISDSAES---IEKTSTAIKVLKEIGAFPDAEKA-KDSHA
CRE10034|RPL4        GNMCRGGRMFAPTKVWRRWHRKINVNQKRYAVVSALAASALPALVMARGHKIEQVPMVPLVLDDAVEG---VKKTSKALEILKKIGALPDVEKS-KDSKS
VOL10037|RPL4        GNMCRGGRMFAPTKVWRRWHRKVNVNQKRYAVCSALAASALPSLVMARGHRIEQVPEVPLVLSDAVEG---LKKTSKALEILKKIGALPDVEKS-KDSKS
HEM10031|rpl1        GNFCRGGRMFSPTTIWRKWHHKIIKNQRRQAVLTSVACSGLVSLVMARGHKISETPEIPLVIESCVES---IICTKFGQTALKNLGAYSDIRDK-LKKKT
PTR10036|RPL4        GNMCRGGRMFDPTKTWRKWNKKINISQKRYAVASALAATAVPALVMSRGHVVDNVPEIPLVVENAVES---AKKTSAAKDILSAIGALDDVEKA-GESKQ
TPS10034|Rpl4        GNMCRGGRMFAPTKTWRKWHRKINVTQKRYAVASALAATAVPALVMARGHKVDDVPEIPLVLDNTLES---AKKTSAAKDILAAVGALADVEKA-ADSKK
CYA10035|RPL4        ANFARGARMFAPTRIWRRWHVKVSRGQRRYAVASALAASALPALVMSRGHRIDSVPELPLVLSEDSES---LRRTKDAVALLKAIGAYEDVEHA-AKSKN
DIC10034|RPL4        GNMCRGGRMYGPNKTWRRWNRKVNVNQKRYAVVSALAASAVPALVMARGHRINGINEVPLVIANESVDT--LQKTKAAVELLKKINAYADVTKV-IDSKH
PLA10038|RPL4        GNMCRGGGMFNPTKIWRRWGRKVNLKEKRYAVCSSIAASGVTSLVLARGHRISHLKEVPLVVSNDIES---LSKTKEAVNFLVSLGLKDEVNRL-VKSKK
TGO10034|RPL4        GNMCRGGGMFAPNKTWRRWHRKVNVTQKRHAVASAVAATGLPALVMARGHRIDEVPELPLVVSEKLEK---VSKTREAVKILETLGCTAELERVRASAKK
GIA10034|Rpl4        ANFARGGHMAHPTTVIRRWCRKVNLNQRRYAVASALAASANAALVEARGHRIADVPSIPLVVDTDN-----VTKTKDALAIIKAVGVLRDVERC-KDSRH


HUM10035|RPL4        MRAGKGKMRNRRRIQRRGPCIIYNEDNG---------IIKAFRNIPGITLLNVSKLNILKLAPGGHVGRFCIWTESAFRKLDELYGTWRK-AASLKSNYN
DOG10034|Rpl4        MRAGKGKMRNRRRIQRRGPCIIYNEDNG---------IIKAFRNIPGITLLNVSKLNILKLAPGGHVGRFCIWTESAFRKLDDLYGTWRK-AASLKSNYN
MUS10034|Rpl4        MRAGKGKMRNRRRIQRRGPCIIYNEDNG---------IIKAFRNIPGITLLNVSKLNILKLAPGGHVGRFCIWTESAFRKLDELYGTWRK-AASLKSNYN
RAT10034|Rpl4        MRAGKGKMRNRRRIQRRGPCIIYNEDNG---------IIKAFRNIPGITLLNVSKLNILKLAPGGHVGRFCIWTESAFRKLDELYGTWRK-AASLKSNYN
CHK10035|Rpl4        MRAGKGKMRNRRRIQRRGPCIIYNEDNG---------IIRAFRNIPGITLLDVNKLNLLRLAPGGHVGRFCIWTESAFRKLDDLYGTWRK-PATLKSDYN
FUG10035|RPL4        MRAGKGKMRNRRRIQRRGPCIVYNQDAG---------VTKAFRNIPGITLQNVNKMNLLRLAPGGHVGRFCIWTESAFRKLDELYGTWRK-PSTQKVDYN
DAN10034|Rpl4        MRAGKGKMRNRRRIQRKGPCIIYNEDNG---------VTRAFRNIPGITLQSVSRLDLLKLAPGGHIGRFCIWTEGAFRKLDDLYGTWRK-ASTLKVDYN
MED10034|Rpl4        MRAGKGKMRNRRRIQRKGPCIIYNQDAG---------LTKAFRNIPGITLQNVNKLNLLRLAPGGHVGRFCIWTESAFRKLDDLYGTWRK-PATLKVDYN
CIO10034|RPL4        IRAGKGKMRNRRHTMKRGPCIIYDKDEG---------ISKAFRNIPGITLISVDRLNLLKIAPGGHVGRFLIWTQSALKRLDGIYGTWRK-PAVEKSAYN
DRO10046|RpL4        FRAGRGTMRDRRRIARRGPLVVYDKDEG---------LRKAFRNIPGIETINVDKLNLLKLAPGGHVGRFVIWTESAFARLNDLFGTWKK-PSTLKKGYN
MOS10034|Rpl4        LRAGRGKMRNRRRVQRRGPLIIYDRDEG---------LRRAFRNIPGVDTMRVSKMNLLKLAPGGHVGRLCVWTESAFAKLDGLYGTWEK-RSVAKKGYN
BEE10035|Rpl4        FRAGKGKMRNRRRIQRRGPLIVYHQDQG---------IRKAFRNIPGVDLMNINKMNLLKLAPGGHVGRFVIWTKSAFEKLDALYGTWRK-ESQLKADYN
CEL10034|rpl-4       NRAGKGKLRNRQHKQKLGPVVIYGQDAE---------CARAFRNIPGVDVMNVERLNLLKLAPGGHLGRLIIWTESAFKKLDTIYGTTVANSSQLKKGWS
BMA10034|RPL4        NRAGKGKGRNRRYKAKLGPLVVYNQDNG---------VVKAFRNIPGVHLLPVDKLNLLKVAPGGHLGRLIIWTESAFRKLNRIYGTETR-KAVAKAKFV
STE10034|RPL4        IRAGKGKMRNRRTVMRKGPLIIYNNDQG---------LRQAFRNLPGVELQHVDRLNLLKLCPGGHLGRFIIWSQGAFEKLDAIYGTWKKASTEKANFN-
MBR10034|RPL4        LRPGHGKWRNRRHIQRRGPLVVYGKNTG---------VVEAFRNLPGVDTCSVDALNLLQLAPGGHVGRFIVWTEDAFNKLDTLFGTQESPADESAKKRR
NEU10035|Rpl4        LRAGKGKLRDRRHRQRRGPLVVYSAETDGK------DLIKGFRNIPGVETSPVDALNLLQLAPGGHLGRFIVWTSAAIKELDAVYES-------KKGFQ-
GRI10034|Rpl4        MRAGKGKLRGRRYRQRRGPLVIYDPATDGT------DLVKGFRNIPGVETSSVYSLNLLQLAPGGHLGRFIVWTSAGFKALDNIYGTTTTPSALKKDFL-
GRA10035|Rpl4        IRAGKGKLRGRRHRQRRGPLVIYSPETDGK------ELVTAFRNITGVETCPVTALNLLQLAPGGHLGRFIVWTSGAFKALDSIYGSTTEASAHKRDFL-
YAR10035|Rpl4        IRAGKGKLRNRRWTQRRGPLVVYSENKG---------LVKAFRNIPGVETCDVRHLNLLQLAPGSHLGRFVIWTEGAFNLLDNIWGS-ESVASAKSGYS-
POM10058|RPL4-2      LRAGKGKLRNRRHVQRRGPLVVFNEDAG---------IVKAFRNIPGVEIVNVRRLNLLQLAPGGHLGRFVIWTKSAFGLLDSVFGSTTEAAQLKKNYF-
POM10059|RPL4-2      LRAGKGKLRNRRHVQRRGPLVVFNEDTG---------IVKAFRNIPGVEIVNVRRLNLLQLAPGGHLGRFVIWTKSAFGLLDSVFGSTTEVAQLKKNYF-
YST10058|RPL4A       LRAGKGKYRNRRWTQRRGPLVVYAEDNG---------IVKALRNVPGVETANVASLNLLQLAPGAHLGRFVIWTEAAFTKLDQVWGS-ETVASSKVGYT-
YST10059|RPL4B       LRAGKGKYRNRRWTQRRGPLVVYAEDNG---------IVKALRNVPGVETANVASLNLLQLAPGAHLGRFVIWTEAAFTKLDQVWGS-ETVASSKVGYT-
CIN10034|Rpl4        IRAGKGKLRNRRHRQRRGPLVVYNEDNG---------IVKAFRNLPGVELVNVRRLNLLQLAPGGHLGRFVIWTQGAFALLDDVYGTFDKASVHKKDYL-
NEA10034|Rpl4        IRAGKGKMRNRRYRQRRGPLVVYAKDEG---------IVRAFKNVPGVETCPVESLNLLQLAPGGHVGRFVIWTESAIAALDSVYE-------KKSGFN-
MAY10034|Rpl4        IRAGVGKLRNRRHTQRRGPLVIYNKDAG---------IVKAFRNVPGVELCSVERLNLLQLAPGGHLGRFVIFTQSAFGRLDEVFA-------AKTGFT-
RHI10129|Rpl4        LRAGQGKLRNRRHRQRRGPLVIYNEDNG---------LVKAFRNLPGLELVNVRRLNLLQLAPGGHLGRFIIWTQSAFTLLDELYGTYETPAALKKDYV-
RHI10130|Rpl4-2      LRAGQGKLRNRRHRQRRGPLVIYNEDNG---------LVKAFRNLPGLELVNVRRLNLLQLAPGGHLGRFIIWTQSAFALLDELYGTYETPATLKKDYV-
RHI10131|Rpl4-3      LRAGQGKLRNRRHRQRRGPLVIYNEDNG---------LVKAFRNLPGLELVNVRRLNLLQLAPGGHLGRFIIWTQSAFTLLDELYGTYETPATLKKDYV-
ARA10095|At3g09630   IRPGKGKMRNRRYISRKGPLVVYGTEGSK--------IVKAFRNLPGVELCHVERLNLLKLAPGGHLGRFVIWTKSAFEKLESIYGSFEKPSEKKKGYV-
ARA10096|RPL4D       IRPGKGKMRNRRYISRKGPLVVFGTEGAK--------IVKAFRNLPGVELCHVERLNLLKLAPGGHLGRFVIWTKSAFEKLESIYGSFEKPSEKKKGYV-
RIC10108|11673.m0076 IRPGKGKMRNRRYINRKGPLIVYGTEGSK--------IVKAFRNLPGVDVANVERLNLLDLAPGGHLGRFVIWTESAFKKLEEVYGTFEAPSLKKKGFI-
RIC10109|RPL4D       IRAGKGKMRNRRYINRKGPLIVYGTEGSK--------VVKAFRNLPGVDVANVERLNLLDLAPGGHLGRFVIWTECAFKKLDEVYGGFDTPALKKKGFV-
GMA10170|LOC10077976 IRPGKGKMRNRRYISRRGPLVVYGTEGAK--------AVKAFRNVPGVEVANVERLNLLKLAPGGHLGRFVIWTKSAFEKLDSIYGSFDKPSEKKKGYL-
GMA10171|LOC10079671 IRPGKGKMRNRRHISRKGPLIVYGTEGAK--------VVKAFRNIPGVEVANVDRLNLLKLAPGGHLGRFIIWTKSAFEKLDSIYGSFHKASEKKKGYL-
GMA10172|LOC10078682 IRPGKGKMRNRRYISRRGPLIVYGTEGAK--------AVKAFRNVPGVEVANVERLNLLKLAPGGHLGRFVVWTKSAFEKLDSIYGSFDKPSEKKKGYL-
GMA10173|LOC10081963 IRPGKGKMRNRRYISGKGPLIVYGTEGAK--------AIKAFRNIPGVEVANVDRLNLLKLAPGGHLGRFIIWTKSAFEKLDSIYGSFDKASEKKNGYL-
POP10034|RPL4        IRPGKGKMRNRRYISRKGPLIVYGTEGAK--------MVKAFRNIPGVEVANVERLNLLKLAPGGHLGRFVIWTKSAIEKLDSIYGSFEKCSEKKKGYV-
CRE10034|RPL4        LRAGKGKMRNRRYVMRKGPLVVFANDEG---------ISKAFRNLPGVEVTSVDRLNLLQLAPGGHLGRFCIWSKSAFEKLDKVFGTATTESEQKKGYK-
VOL10037|RPL4        LRSGKGKLRNRRYVMRKGPLVVFANDEG---------ISKAFRNLPGVEVTSVDRLNLLQLAPGGHLGRFCIWSKSAFEKLDKIFGTATSESEVKKGFK-
HEM10031|rpl1        LKAGKGKLRNRRRKKYLGPLIIFEKNAR------------AFRNIPGIETCCIDYLNIQKLAPGGHVGRFCIWTYKSFSKLDQIYYQGNLNSFSKNEKKK
PTR10036|RPL4        IRAGKGKMRNRRYTLRRGPLVIYKSNDG---------VEQAFRNLPGVELCCVDRLNLLQLAPGGHMGRFCIWSQAALEELDIIYG--------ENGKR-
TPS10034|Rpl4        IRAGKGKARNRRYTLRRGPLVIYKSNDG---------VEQAFRNLPGVELCCVDRLNLLQLAPGGHMGRFCIWSQAALDALNTIYG--------KEGKS-
CYA10035|RPL4        QRAGRGKMRNRRYTMRRGPLIIYANSEKDPKSGAPDNLSRAFRNLPGVECCHVERLNLLQLAPGGHLGRFCIFTKQAFERLDEIYATGKSG---------
DIC10034|RPL4        IRAGAGKARNRRYKVRKGPLVVVSGKTTVS---------QALRNIPGVEVANVSRLNLLKLAPGGHLGRFIIWTKSAFEQLDSTFGTFAKSSAQKKGYT-
PLA10038|RPL4        IRAGKGKMRNRKYKIRNGPLIIYENDNG---------VKKAFRNIPGVDLCKVTKLNLLKLAPGGSIGRLCIWSESAFKKLDVIYGKIHEKKVTKKNYIL
TGO10034|RPL4        LRAGKGKMRGRRTHMRRGPLVVYAEDNG---------VTRAFRNIPGVELCKVDSLNLLQLAPGGALGRFCLYTASAFKRLQLLFGRHTGTGTAQLKKG-
GIA10034|Rpl4        IRAGRGKMRNRRYITRKGPLVIYN----------TEDVARGFRNLPGVDLCHVSSIRLLELAPGSHPGRLILWTKSAFASLDDVYAAKQN----------


HUM10035|RPL4        -----LPMHKMINTDLSRILKSPEIQRALRAPRK---KIHRRVLKKNPLKNLRIMLKLNPYAKTMRRNTILRQARNHKLRVDKAAAAAAALQAKSDEKAA
DOG10034|Rpl4        -----LPMHKMLNTDLSRILKSPEIQRALRAPRK---KIHRRVLKKNPLKNLRIMLKLNPYAKTMRRNTILRQAKNHKLRMDKAAAALEAKSEEK----G
MUS10034|Rpl4        -----LPMHKMMNTDLSRILKSPEIQRALRAPRK---KIHRRVLKKNPLKNLRIMLKLNPYAKTMRRNTILRQARNHKLRVKKLEAAATALATKS-----
RAT10034|Rpl4        -----LPMHKMMNTDLSRILKSPEIQRALRAPRK---KIQRRVLKKNPLKNLRIMLKLNPYAKTMRRNTILRQARNHKLRVKKLEAAAAALAAKS-----
CHK10035|Rpl4        -----LPMHKMTNTDLGRILRSQEIQKALRAPKK---KIHRRVLKKNPLKNLRVMIKLNPYAKTMRRNTILRHAQNQKLKEEKKAKAKASVTSKAKLSAK
FUG10035|RPL4        -----LPMHKMTNTDLSRILKSEEIQKALRPPKK---KIIRRVLKKNPLKNLRIMLKLNPYSKTARRHAILKHNPEIKAKMLKPKKKPKKKVEAAKPKA-
DAN10034|Rpl4        -----LPMHKMSITDLNRIIKSEEVQKAIRPANR---KINRRVFKKNPLKNLRVMMKLNPYAKTARRRAIMAHNPDVKAKMLKPKKKRVVKKTKAKKAEA
MED10034|Rpl4        -----LPMHKMTNTDLSRILKSEEIQKALRAPNK---KINRRVMKKNPLKNLKIMFKLNPYAKTVRRHAILKHDPTIKAKMLKPKKRSAKKKGAEKPKA-
CIO10034|RPL4        -----LPMPKMTCTDLSKILQSTEVKSALRAPKK---GIARRSQKKNPLKNIRAMLKLNPAAASAKRSAILLQERRVREKAELKAKKAKA----------
DRO10046|RpL4        -----LPQPKMANTDLSRLLKSEEIRKVLRDPRK---RVFRSVRRLNPLTNVRQLIKLNPYAEVLKRRAALAAEKRTVAKVLAKAKKQNVELAKSHFANV
MOS10034|Rpl4        -----LPTPIMANTDLTRLLKSEEIRRVLRAPRR---KVYRHVRRLNPLTNKEQMLKLNPYAAVTKRRAQLMTKLRKCERLVAKAEAKKKPLDAKHRAVV
BEE10035|Rpl4        -----LPFPKMMNTDLSRLLKSQEIRKVLRAPRK---KVVRRVKKLNPLSNTRAMLRLNPYAAVLKRAAILTARKRQQERELALAEKRGVKLPKSTPAVK
CEL10034|rpl-4       -----VPLPIMANSDFSRIIRSEEVVKAIRAPKK---NPVLPKVHRNPLKKRTLLYKLNPYASILRKASKANVKK-------------------------
BMA10034|RPL4        -----MPTAKMANADFSRLIRSEEIVKAIREKKKKIFKVRASRMHRNPLKKSAIMVKLNPYAAVLKRTAVLTNRRRLGTQHPFEEKIQISRRKEFKKKAA
STE10034|RPL4        -----LPRPIMLNSDLTRLINSEEIQSVIRP--MKPK-ARRAIHKKNPLKNLGTMLRLNPYAKSAKRAEMLTVERRRAAKEAALAKKRGK----------
MBR10034|RPL4        NAPYHMPRHKMANADLARIINSDEIQSAVRP--VKTG-GVHATQRKNPLKNLNVLLRLNPYAKVWKRHETIQADKRHAARQQAANAKRA-----------
NEU10035|Rpl4        -----LPANVVAQADLTRLINSSEIQSVLRTPKGDAKTKRSNVQKKNPLRNKQVLLRLNPYAATFAKEKLGEIKEEGKPQRVPATFKTLLQE--------
GRI10034|Rpl4        -----LPSNVVSQADLTRLINSSEIQSVLRAPKGTARTKRQGCLKKNPLRNKQILLRLNPYASAYQKNKLGEEKLREGKPEVPEAFKTQLHEN-------
GRA10035|Rpl4        -----LPSNVVSQADLTRLINSSEIQSSINAPKGDAITRRSAVQKKNPLKNKQVMLRLNPYATVFAQEAQKKQN--------------------------
YAR10035|Rpl4        -----LPANILANADVSRIIESQEIQSILKP-AKEIQEK--DIRKMNPLKNKQELLRLNPYSKTFAEKKLGSIKEPKTKVKNAQKAKFMQILKDN-----
POM10058|RPL4-2      -----LPENIISNADVTRLINSDEIQSIVKA-AGPSRVKRAHVQKKNPLKNKAVLARLNPYAKAYKAN--------------VKLNTGKTPKAAGEKFLT
POM10059|RPL4-2      -----LPENIISNADVTRLINSDEIQSIVKA-AGPSRVKRAHVQKKNPLKNKAVLSRLNPYAKAYKAN--------------VKINSEKTPKAAGEKFLS
YST10058|RPL4A       -----LPSHIISTSDVTRIINSSEIQSAIRP-AGQATQKRTHVLKKNPLKNKQVLLRLNPYAKVFAAEKLGSKKAEKTGTKPAAVFTETLKHD-------
YST10059|RPL4B       -----LPSHIISTSDVTRIINSSEIQSAIRP-AGQATQKRTHVLKKNPLKNKQVLLRLNPYAKVFAAEKLGSKKAEKTGTKPAAVFAETLKHD-------
CIN10034|Rpl4        -----LPTAKISNPDVTRLINSDEIQSVVRP-AGQKIQKRPWAQRKNPLVNKAVLFRLNPYAKTLRRQELLKQERIKAKKAKKPKAPK----SAGKVFLE
NEA10034|Rpl4        -----LPTAKISTSDVTRLINSDEIQSVVRP-AGQAVQKRPFTQKKNPLRNKAVLFRLNPYAKSLRRQELLASQ-RKAKGSVKKSVPG----SAGKEFLE
MAY10034|Rpl4        -----LPKAKIANTDVTRIINSDEIQSVVRA-KGPAKTTRPFTQRKNPLKNRAVLFRLNPYAQAAIRSEIRAQAAKKSG--FKKEAKQ----PVAKEFLQ
RHI10129|Rpl4        -----LPAHIMTNPDVARLINSDEIQSVVRP-AGNKHHKRPFTQKKNPLKNQGVMNRLNPYAQVLRRAEIIKAQKVANGKVAKVQKKKPTSTAANKKFLE
RHI10130|Rpl4-2      -----LPAHIMTNPDVARLINSDEIQSVVRP-AGNKHHKRPFTQKKNPLKNQGVMNRLNPYAQVLRRAEIIKAQKVANGKVAKVQKKKPTSTAANKKFLE
RHI10131|Rpl4-3      -----LPAHIMTNPDVARLINSDEIQSVVRP-AGNKHHKRPFTQKKNPLKNQGVMNRLNPYAQVLRRAEIIKAQKVANGKVAKLQKKKPTSTAANKKFLE
ARA10095|At3g09630   -----LPRAKMVNADLARIINSDEIQSVVNP--IKKD-AKRAVLKKNPLKNLNVMLKLNPYAKTAKRMSLLAEAQRVKAKKEKLAKKRKTVTK--EEALA
ARA10096|RPL4D       -----LPRAKMVNADLARIINSDEVQSVVNP--IKDG-SKRAVLKKNPLKNLNVMFKLNPYAKTAKRMSLLAEASRVKAKKEKLEKKRKVVTK--EEAQA
RIC10108|11673.m0076 -----LPRPKMANADLGRIINSDEVQSVVKP--LNKE-VKRREKRKNPLKNVAAVLKLNPYFGTARKMATLAEAARIKARKEKLDSKRTKLSP--EEAAK
RIC10109|RPL4D       -----LPRPKMANADLSRLINSDEVQSVVKP--INKE-VKLREARRNPLKNVAAVLKLNPYFGTARKMAALAEAARVKARTEKLDSKRTKLSP--EESSK
GMA10170|LOC10077976 -----LPRSKMVNSDLSRIINSDEVQSVVRP--IKKD-VKRATLKKNPLKNLNSMLKLNPYAKTAKRMALLAEAQRVKVKKEKLDKKRKTVSK--EEASA
GMA10171|LOC10079671 -----LPRPRMVNSDLARIINSDEVQSVVRP--IKKD-VKRAPLKKNPLTNLNAMLKLNPYAKTAKRMALLAEKQRIVAKKEKLDKKRNIVSK--EEASA
GMA10172|LOC10078682 -----LPRPKMVNSDLARIINSDEVQSVVRP--IKKD-VKKATLKKNPLKNLNSMLKLNPYAKTAKRMALLAEAQRVKAKKEKLDKKRKTVSKQ-EEASA
GMA10173|LOC10081963 -----LPRPKMINSDLARIINSDEVQSVVRP--IKKD-VKRAPLKKNPLTNLNAMLKLNPYAKTAKRMALLAEKQRIVAKKEKLHKKRNIVSK--EEASA
POP10034|RPL4        -----LPRSKMVNADLARIINSDEVQSVVKP--IKRE-VKRATLKKNPLKNLNVLLKLNPYAKTARRMALLAEAERVKSKKEKLDRKRKPVSK--EELAA
CRE10034|RPL4        -----LPRACMANGDLARLINSDEIQSAVRP--AKSAGPKHAPLKKNPLRNLGAMLKLNPYAKVARRVEITRSTKKAAKRSEKLAKIAKGEKTGGQKDKA
VOL10037|RPL4        -----VPRSVMTNGDLTRIINSDEIQSAVRP--AKAAGPKHAPLKKNPLRNLGALLKLNPYAKVARRIEITCSAKKGAVRAEKLEKIAKGIATGAKKDKA
HEM10031|rpl1        ------ENNLMTNSNLKVVINSNRIQNDINPPSKKIKNFVGRKI--------------------------------------------------------
PTR10036|RPL4        -----IPQAAMTNADLARIINSDEVQSVVNP--AKPG-QKDNAPKQNAIRNVEALEKLDPFAAEKRRAQARNDEARASKKAETLAKKRDSRTA----KKA
TPS10034|Rpl4        -----IPEDLMANADLARIINSDEIQSVLNP--AKRA-NKKFLRKKNPLTSIKALAKLDPYAAAARESEQRAEAARKDQKAAILKKRRETAKG----KKQ
CYA10035|RPL4        ---FKFPRAVMTQADLSRIINSDEVQSALRP---IRRVPRLPRLKRNALRNRRMMRLLNPAYDAFIRKMSERVPDASRRLPASERARVRAIGKRYIRQLL
DIC10034|RPL4        -----LPRPMIANADIVRLVNSDEIQAAVRASKVVVKRPTAPVRRSNPLKNLRAMIKLNPAAVSTRRTQVKSLKSKGIKVSKKNQLRAKLVAATFNQ---
PLA10038|RPL4        ------PKSIVHNPDIYRIIHSDKVQASLLAK---KKPCKKRLQNKNSLTNFAVRCRLNPAYKLLRSLAVLRMRKSILEKSKNKKEKRVQKQIQKKELQK
TGO10034|RPL4        ---YHLPRALMSNADLSRIVNSEEIQRVVRP--ARVAPQKKRGQKKNLLKNHAVLCRVNPAARNLKILARLAQTEGTKQRALVLRKKQANREEHKKHRQS
GIA10034|Rpl4        ---YTLPRSCITQTDIERILQSDAVQKTFVP---KR-DPLVIERKVDPFSSKEALARLDPSGTVMPK---------------------------------


HUM10035|RPL4        VAGKKPVVGKKGKKAAVGVKKQKKPLVGKKAAATKKPAPEKKPAEKKPTTEEKKPAA-----
DOG10034|Rpl4        VPGKKPTVGKKGK-KTVGVKKPKKPVVGKKAAATKKPAADKKPAEKKPTTEEKKPAA-----
MUS10034|Rpl4        -EKVVPEKGTADKKPAVGKKGKK--VDAKKQKPAGKKVVAKKPAEKKPTTEEKKPAA-----
RAT10034|Rpl4        -EKIVPEKGAGDKKPAVGKKGKKPVDAKKLKKPAGKKVVTKKPAEKKPTTEEKKSAA-----
CHK10035|Rpl4        AQTKAKPASKTAGKAAAKGPAKAPAKAPAKSAAKAPAKSPAKAPAKGKAEA-----------
FUG10035|RPL4        --------------------------------------------------------------
DAN10034|Rpl4        TPAQA---------------------------------------------------------
MED10034|Rpl4        --------------------------------------------------------------
CIO10034|RPL4        --------------------------------------------------------------
DRO10046|RpL4        ATKAAAN----RAKLLAARKKKVAAKKPAAKK------------------------------
MOS10034|Rpl4        FVEKQTRRLQKMEKIKAARKEKVDKKVADFKASGKKPSLKKVRPAKEAAKPVKKAVKKVEKK
BEE10035|Rpl4        TKLLLERRRKQILAARAAKPKKAVKAKSATSAAKPAKTTKASEKSAKSSQKAAPAKK-----
CEL10034|rpl-4       --------------------------------------------------------------
BMA10034|RPL4        RKTTAAQKTPAPK-------------------------------------------------
STE10034|RPL4        --------------------------------------------------------------
MBR10034|RPL4        --------------------------------------------------------------
NEU10035|Rpl4        --------------------------------------------------------------
GRI10034|Rpl4        --------------------------------------------------------------
GRA10035|Rpl4        --------------------------------------------------------------
YAR10035|Rpl4        --------------------------------------------------------------
POM10058|RPL4-2      VLHEN---------------------------------------------------------
POM10059|RPL4-2      VLHEN---------------------------------------------------------
YST10058|RPL4A       --------------------------------------------------------------
YST10059|RPL4B       --------------------------------------------------------------
CIN10034|Rpl4        NLLAP---------------------------------------------------------
NEA10034|Rpl4        ILHAA---------------------------------------------------------
MAY10034|Rpl4        LLHAN---------------------------------------------------------
RHI10129|Rpl4        TLHSA---------------------------------------------------------
RHI10130|Rpl4-2      TLHSA---------------------------------------------------------
RHI10131|Rpl4-3      TLHST---------------------------------------------------------
ARA10095|At3g09630   IKAAGKSWYKT------MISDSDYTEFDNFTKWLGASQ------------------------
ARA10096|RPL4D       IKAAGKAWYQT------MISDSDYTEFDNFTKWLGASQ------------------------
RIC10108|11673.m0076 VKAAGKAWYKT------MISDSDYAEFDNFSKWLGVTQ------------------------
RIC10109|RPL4D       IKAAGKAWYKT------MISDSDYTEFENFSKWLGVTQ------------------------
GMA10170|LOC10077976 IKAAGKAWYHT------MVSDSDYTEFDNFSKWLGVSQ------------------------
GMA10171|LOC10079671 IKSAGKSWYQT------MVSDSDYADFDNFSKWLGVSQ------------------------
GMA10172|LOC10078682 IKSAGKAWYHT------MVSDSDYTEFDNFSKWLGVSQ------------------------
GMA10173|LOC10081963 IKAAGKSWYQT------MVSDSDYAEFDNFSKWLGVSQ------------------------
POP10034|RPL4        AKAAGKAWYKT------MISDSDYTEFENFTKWLGVSQ------------------------
CRE10034|RPL4        IKAIGKKFYKNVSCSMLVESDYAGDDYDLFARWITVQKQTKTA-------------------
VOL10037|RPL4        VKAIGKAFYK----KMLVDSDYSGEDYDQFARWITVQKQTKTA-------------------
HEM10031|rpl1        --------------------------------------------------------------
PTR10036|RPL4        FKEQGKSFYAK-------VSQQGTVCENGFALE-----------------------------
TPS10034|Rpl4        HRAQGQAFFAK-------VSKQGDVCANGFALA-----------------------------
CYA10035|RPL4        DTNPTEV-------------------------------------------------------
DIC10034|RPL4        --------------------------------------------------------------
PLA10038|RPL4        INHDYYKGVAKAVKKKKKREEKKAKSKKTANQAVINVAAEE---------------------
TGO10034|RPL4        ARRFAAEIRQAFSDKMAAELEAAARRKAEEAGAIAQASAEEE--------------------
GIA10034|Rpl4        --------------------------------------------------------------