CLUSTAL W (2.1) Multiple Sequence Alignments
HUM10076|RPL40       MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKE-GIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG--IIEPSLRQLAQKYNCDKMICR
DOG10075|Rpl40       MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKE-GIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG--IIEPSLRQLAQKYNCDKMICR
MUS10075|Rpl40       MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKE-GIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG--IIEPSLRQLAQKYNCDKMICR
RAT10075|Uba52       MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKE-GIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG--IIEPSLRQLAQKYNCDKMICR
FUG10076|RPL40       MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKE-GIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG--IIEPSLRMLAQKYNCDKMICR
DAN10075|Rpl40       MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKE-GIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG--IIEPSLRQLAQKYNCEKMICR
MED10075|Rpl40       MQIFVKTLTGKTITLEVEASDTIENVKAKIQDKE-GIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG--IIEPSLRQLAQKYNCDKMICR
CIO10075|RPL40       MQIFVKTLTGKTITLEVEASDMIDNVKQKIQDKE-GIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG--VIEPSLRILAQKYNCDKMICR
DRO10096|RpL40       MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKE-GIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG--IIEPSLRILAQKYNCDKMICR
MOS10076|Rpl40       MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKE-GIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG--IIEPSLRILAQKYNCDKMICR
BEE10077|Rpl40       MQIFVKTLTGKTITLEVEASDTIENVKAKIQDKE-GIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG--VIEPTLRILAQKYNCDKMICR
CEL10081|rpl-40.1    MQIFVKTLTGKTITLEVEASDTIENVKAKIQDKE-GIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG--IIEPSLRQLAQKYNCDKQICR
BMA10075|RPL40       MQIFVKTLTGKTITLEVESSDTIENVKAKIQDKE-GIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG--IIEPSLRQLAQKYNCEKKICR
STE10075|RPL40       MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKE-GIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG--VIEPSLRILAQKYNCDKMICR
MBR10075|RPL40       MQIFVKTLTGKTITLEVEPSDSIENVKAKIQDKE-GIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG--VIEPNLKLLAQKYNCDKMVCR
NEU10076|Rpl40       MQIFVKTLTGKTITLEVESSDTIDNVKQKIQDKE-GIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG--IIEPSLKALASKFNCDKMICR
GRI10075|Rpl40       MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKE-GIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG--IIEPSLKALASKFNCDKQICR
GRA10076|Rpl40       MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKE-GIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG--IIEPSLKALASKFNCDKMICR
STA10075|Rpl40       MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKE-GIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG--IIEPSLKALASKYNCDKMICR
YAR10077|Rpl40       MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKE-GIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG--IIEPSLKALASKYNCEKAICR
POM10132|RPL40       MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKE-GIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG--IIEPSLKALASKYNCEKQICR
YST10130|RPL40A      MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKE-GIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG--IIEPSLKALASKYNCDKSVCR
YST10131|RPL40B      MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKE-GIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG--IIEPSLKALASKYNCDKSVCR
CIN10076|Rpl40       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE-GIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG--IIEPSLKVLASKYNCDKQICR
NEA10075|Rpl40       MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKE-GIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG--IIEPSLKALASKYNCEKQICR
MAY10075|Rpl40       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE-GIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG--IIEPSLKVLAGKYNCDKQICR
RHI10291|Rpl40       MQIFVKTLTGKTITLEVESSDTIDNVKQKIQDKE-GIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG--IIEPSLKALASKYNCEKMICR
RHI10292|Rpl40-2     MQIFVKTLTGKTITLEVESSDTIDNVKQKIQDKE-GIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG--IIEPSLKALASKYNCEKMICR
RHI10293|Rpl40-3     MQIFVKTLTGKTITLEVESSDTIDNVKQKIQDKE-GIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG--IIEPSLKALASKYNCEKMICR
RHI10294|Rpl40-4     MQIFVKTLTGKTITLEVESSDTIDNVKQKIQDKE-GIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG--IIEPSLKALASKYNCEKMICR
ARA10208|RPL40A      MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE-GIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG--IIEPSLMMLARKYNQDKMICR
ARA10209|RPL40B      MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE-GIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG--IIEPSLMMLARKYNQDKMICR
RIC10255|RPL40A      MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE-GIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG--IIEPSLQALARKYNQDKMICR
RIC10259|RPL40A      MQIFVKTLTGKTITLEVENSDAVANVKAKIQDKE-GIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGHIWIEPSLRVLAYKHNINKMVCR
GMA10382|LOC10081828 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE-GIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG--IIEPSLMALARKYNQDKMICR
GMA10383|LOC10079220 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE-GIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG--IIEPSLMALARKYNQDKMICR
GMA10384|LOC10030662 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE-GIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG--IIEPSLMALARKYNQDKMICR
GMA10385|LOC10080078 MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE-GIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG--IIEPSLMALARKYNQDKMICR
POP10076|RPL40       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE-GIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG--IIEPSLMALARKYNQEKMICR
CRE10075|RPL40       MQIFVKTLTGKTITLEVESSDTIENVKAKIQDKE-GIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG--IIEPSLQALARKYNQEKMICR
VOL10080|RPL40       MQIFVKTLTGKTITLEVESSDTIENVKAKIQDKE-GIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG--IIEPSLQALARKYNQEKMICR
HEM10064|rpl40       -------------------------------------------------------------------MFLIPSLRGG--IIEPTLAALARKKNCEKVICR
PTR10078|RPL40       MQIFVKTLTGKTITLDVEPSDTIDNVKTKIQDKE-GIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG--VYDPSLALLAKGFNCDKAVCR
TPS10076|Rpl40       MQIFVKTLTGKTITLDVEPSDTIDNVKTKIQDKE-GIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG--VYDPTLALLAKKYNCEKSICR
CYA10076|RPL40       MQIFVKTLTGKTITLEVEPSDTIENVKSKIQDKE-GIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG--LIEPSLAALARQYNCEKMICR
DIC10075|RPL40       MQIFVKTLTGKTITLEVEGSDNIENVKAKIQDKE-GIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRG---GIEPSLVILARKYKCDKMICR
PLA10080|RPL40       MQIFVKTLTGKTITLDVEPSDTIENVKAKIQDKE-GIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG--AIEPSLAQLAQKYNCQKLICR
TGO10075|RPL40       MQIFVKTLTGKTITLDVEPSDTIENVKAKIQDKE-GIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG--IIEPSLALLAQKYNCEKKVCR
GIA10075|Rpl40       MQLIVRSLD-RTVALTASPADSLTSIRQRLLAVYSGHVVDSQRFVFAGRTLDEAKTLGDYSIGESSVLDLVPRLFGG--VMEPTLINLAREYNQNMMICR
HAL10055|VNG2076G    ------------------------------------------------------------------------------------MSETIEDRLLNKQVCM
MET10060|MJ0707      -----------------------------------------------------------------------------------MPFEEAMKRLFMKKICM
PYR10056|PHS037      ----------------------------------------------------------------------------------MARFPEAEARIFKKYICL
SUL10064|STS025      -----------------------------------------------------------------------------MPLTDPVKLQIVQQRIFLKKVCR


HUM10076|RPL40       KCYARLHPRAVNCRKKKCGHTNNLRPKKKVK------
DOG10075|Rpl40       KCYARLHPRAVNCRKKKCGHTNNLRPKKKVK------
MUS10075|Rpl40       KCYARLHPRAVNCRKKKCGHTNNLRPKKKVK------
RAT10075|Uba52       KCYARLHPRAVNCRKKKCGHTNNLRPKKKVK------
FUG10076|RPL40       KCYARLHPRAVNCRKKKCGHTNNLRPKKKLK------
DAN10075|Rpl40       KCYARLHPRAVNCRKKKCGHTNNLRPKKKLK------
MED10075|Rpl40       KCYARLHPRAVNCRKTKCGHTNNLRPKKKLK------
CIO10075|RPL40       KCYARLHSRATNCRKKKCGHTNHLRPKKKLK------
DRO10096|RpL40       KCYARLHPRATNCRKKKCGHTNNLRPKKKLK------
MOS10076|Rpl40       KCYARLHPRATNCRKKKCGHTNNLRPKKKLK------
BEE10077|Rpl40       KCYARLHPRATNCRKKKCGHTNNIRPKKKLK------
CEL10081|rpl-40.1    KCYARLPPRASNCRKKKCGHSSELRIKKKLK------
BMA10075|RPL40       KCYARLPPRATNCRKKKCGHSNDLRIKKKPK------
STE10075|RPL40       KCYARLHPRATNCRKKKCGHSNNLRPKKKLK------
MBR10075|RPL40       KCYARLHLRATNCRKKKCGHTTSLRPKKKLK------
NEU10076|Rpl40       KCYARLPPRATNCRKRKCGHTNQLRPKKKLK------
GRI10075|Rpl40       KCYARLPPRATNCRKRKCGHSNQLRPKKKLK------
GRA10076|Rpl40       KCYARLPPRATNCRKRKCGHTNQLRPKKKLK------
STA10075|Rpl40       KCYARLPPRAVNCRKKKCGHTNQLRPKKKLK------
YAR10077|Rpl40       KCYARLPPRATNCRKKKCGHTNQLRPKKKLK------
POM10132|RPL40       KCYARLPPRATNCRKKKCGHTNQLRPKKKLK------
YST10130|RPL40A      KCYARLPPRATNCRKRKCGHTNQLRPKKKLK------
YST10131|RPL40B      KCYARLPPRATNCRKRKCGHTNQLRPKKKLK------
CIN10076|Rpl40       KCYARLPPRATNCRKRSCGHSSQLRPKKKLK------
NEA10075|Rpl40       KCYARLPPRATNCRKRKCGHSSQIRPKKALKK-----
MAY10075|Rpl40       KCYARLPPRATNCRKRKCGHSSQLRPKKKLK------
RHI10291|Rpl40       KCYARLPPRATNCRKRKCGHTNQLRPKKKLK------
RHI10292|Rpl40-2     KCYARLPPRATNCRKRKCGHTNQLRPKKKLK------
RHI10293|Rpl40-3     KCYARLPPRATNCRKRKCGHTNQLRPKKKLK------
RHI10294|Rpl40-4     KCYARLPPRATNCRKRKCGHTNQLRPKKKLK------
ARA10208|RPL40A      KCYARLHPRAVNCRKKKCGHSNQLRPKKKIK------
ARA10209|RPL40B      KCYARLHPRAVNCRKKKCGHSNQLRPKKKIK------
RIC10255|RPL40A      KCYARLHPRAVNCRKKKCGHSNQLRPKKKIKN-----
RIC10259|RPL40A      KCYATLPPRATNCRKKKCGHSNQLRPKKVRWCRYFNF
GMA10382|LOC10081828 KCYARLHPRAVNCRKKKCGHSNQLRPKKKIK------
GMA10383|LOC10079220 KCYARLHPRAVNCRKKKCGHSNQLRPKKKIK------
GMA10384|LOC10030662 KCYARLHPRAVNCRKKKCGHSNQLRPKKKIK------
GMA10385|LOC10080078 KCYARLHPRAVNCRKKKCGHSNQLRPKKKIK------
POP10076|RPL40       KCYARLHPRAVNCRKKKCGHSNQLRPKKKIK------
CRE10075|RPL40       KCYARLHPRAKNCRKKSCGHTNQLRPKKKLK------
VOL10080|RPL40       KCYARLHPRAKNCRKKSCGHTNQLRPKKKLKV-----
HEM10064|rpl40       KCYARLHPKAKNCRKKKCGHSSQLRMKKKLK------
PTR10078|RPL40       KCYARLPPRATNCRKKKCGHTSQLRPKKKLK------
TPS10076|Rpl40       KCYARLPPKATNCRKRKCGHSSQLRPKKKLK------
CYA10076|RPL40       RCYARLPARAHNCRKRKCGHSSNLRPKKKIK------
DIC10075|RPL40       KCYARLHPRAVNCRKKKCGHSNNLRPKKKLLK-----
PLA10080|RPL40       KCYARLHPRATNCRNKKCGRTNQLRPKKKLK------
TGO10075|RPL40       KCYARLPPRATNCRKKKCGHSNQLRPKKKPKN-----
GIA10075|Rpl40       HCYARNPLRATNCRRCRG---TNLRKKKLSKYA----
HAL10055|VNG2076G    RCNARNPTDAESCR--KCGYKNLRTKASERRSA----
MET10060|MJ0707      RCNARNPWRATKCR--KCGYKGLRPKAKEPRG-----
PYR10056|PHS037      RCGATNPWGAEKCR--KCGYKRLRPKAREPRGGGR--
SUL10064|STS025      DCGALNSVRATKCR--RCHSKNLRPKKKELPAKKG--