CLUSTAL W (2.1) Multiple Sequence Alignments
HUM10036|RPL5        -MGFVKVVKNKAYFKRYQVKFRRRREGKTDYYARKRLVIQDKNKYNTPKYRMIVRVTNRDIICQIAYARIEGDMIVCAAYAHELP-KYGVKVGLTNYAAA
DOG10035|Rpl5        -KGFVKVVKNKAYFKRYQVKFRRRREGKTDYYARKRLVIQDKNKYNTPKYRMIVRVTNRDIICQIAYARIEGDMIVCAAYAHELP-KYGVKVGLTNYAAA
MUS10035|Rpl5        -MGFVKVVKNKAYFKRYQVRFRRRREGKTDYYARKRLVIQDKNKYNTPKYRMIVRVTNRDIICQIAYARIEGDMIVCAAYAHELP-KYGVKVGLTNYAAA
RAT10035|Rpl5        -MGFVKVVKNKAYFKRYQVRFRRRREGKTDYYARKRLVIQDKNKYNTPKYRMIVRVTNRDIICQIAYARIEGDMIVCAAYAHELP-KYGVKVGLTNYAAA
CHK10036|Rpl5        -MGFVKVVKNKAYFKRYQVKFRRRREGKTDYYARKRLVIQDKNKYNTPKYRMIVRVTNRDIICQIAYARIEGDMIVCAAYAHELP-KYGVKVGLTNYAAA
FUG10036|RPL5        -MGFVKVVKNKAYFKRYQVKFRRRREGKTDYFARKRLVVQDKNKYNTPKYRMIVRFSNRDIVCQIAYAKIEGDMIVCAAYSHELP-KYGVSVGLTNYAAA
DAN10035|Rpl5        -MGFVKVVKNKSYFKRYQVKFRRRREGKTDYFARKRLVIQDKNKYNTPKYRMIVRFSNRDIVCQIAYAKIEGDMIVCAAYSHELP-KYGISVGLTNYAAA
MED10035|Rpl5        -MGFVKVVKNKAYFKRYQVKFRRRREGKTDFFARKRLVVQDKNKYNTPKYRMIVRFSNRDIVCQIAYAKIEGDMIVCAAYSHELP-KYGVTVGLTNYAAA
CIO10035|RPL5        -MGFVKVVKNKAYFKRYQVKYRRRREGVTDYFARKRLVVQDRNKYNTPKYRMIVRFTNKDIITQIAYARIEGDVVICAAYAHELP-RYGVKVGLTNYSAA
DRO10048|RpL5        -MGFVKVVKNKQYFKRYQVKFRRRREGKTDYYARKRLTFQDKNKYNTPKYRLIVRLSNKDITVQIAYARIEGDRVVCAAYSHELP-KYGIQVGLTNYAAA
MOS10035|Rpl5        -MGFVKVVKNKQYFKRYQVRFRRRREGKTDYYARKRLIFQDKNKYNTPKFRLIVRLSNRDITCQIAYARIEGDRIVCAAYSHELP-RYGVKVGLTNYAAA
BEE10036|Rpl5        -MGFVKVVKNKQYFKRYQVKFRRRREGKTDYYARKRLTIQDKNKYNTPKYRLIVRLSKKYITCQVAYSRIEGDRIVCAAYSHELP-KYGIKVGLTNYASA
CEL10035|rpl-5       -MGLVKVIKNKAYFKRYQVKLRRRREGKTDYYARKRLTVQDKNKYNTPKYRLIVRITNKDVVAQLAYSKIEGDVVVASAYSHELP-RYGLKVGLTNYAAA
BMA10035|RPL5        -MGFVKVVKNKAYFKRYQVKLKRRREGKTDYYARKRLTVQDKNKYNTPKYRLIVRFTNRDVIAQIAYSRIEGDVVVCSAYSHELP-RYGIKVGLTNYASA
STE10035|RPL5        -MGFVKVVKNKAYFKRFQVKFKRRREGKTDYYARKRLITQDKNKYNTPKYRFVVRFTNKDITCQIAYAKLEGDVIICAAYAHELP-RYGVKVGLTNYAAA
MBR10035|RPL5        -MGSGPNQMDKAYYKRFQVKYRRRREGKTDYYARTRLVRQEKNKYNTPKYRLIVRRTTSDVVAQIAYSRLEGDYIMAAAYSHELP-QFGFKVGLTNWSAC
NEU10036|Rpl5        -MAFHKLVKNSAYYSRFQTKYKRRREGKTDYYARKRLITQAKNKYNAPKYRLVVRFTNRDIILQIVSSEITGDKVFASAYSHELK-AYGIEHGLTNWAAA
GRI10035|Rpl5        -MPFHKLVKNSAYYSRFQTKYKRRQQGKTDYYARKRLITQAKNKYNAPKYRLVVRFTNRDIIMQIVTSEISGDKVFASAYSHELK-AYGITHGLTNWAAA
GRA10036|Rpl5        --MPFKLVKNSAYYSRYQTKYKRRQQGKTDYYARKRLITQAKNKYNAPKYRLVVRFTNKDIICQIVTSEISGDKVFISAYAHELK-AYGIEHGLTNWAAA
STA10035|Rpl5        -MPFSKLQKNDAYFSRYQVKYKRRRQGKTDYYARKRLITQAKNKYNAPKYRLVVRFTNKDIVAQIVHSEIGGDKVFMAAYAHELK-PYGITHGLTNWSAA
YAR10036|Rpl5        -MSFNKIVKTSAYHSRFQTPFRRRREGKTDYYARKRLVTQHKAKYNTPKYRLVVRFTNKDIIAQIVSSQLKGDIVFTAAYAHELP-RYGVKHGLTNWAAA
POM10060|RPL5-1      -MPFIKAVKSSPYFSRYQTKYRRRREGKTDYYARKRLIAQAKNKYNAPKYRLVVRFSNRFVTCQIVSSRVNGDYVLAHAHSSELP-RYGIKWGLANWTAA
POM10061|RPL5-2      -MPFIKAVKSSPYFSRYQTKYRRRREGKTDYYARKRLIAQAKNKYNAPKYRLVVRFSNRFVTCQIVSSRVNGDYVLAHAHSSELP-RYGIKWGLANWTAA
YST10060|RPL5        -MAFQKDAKSSAYSSRFQTPFRRRREGKTDYYQRKRLVTQHKAKYNTPKYRLVVRFTNKDIICQIISSTITGDVVLAAAYSHELP-RYGITHGLTNWAAA
CIN10035|Rpl5        -MPFVKKQKTDAYFSRFQVKFRRRREGKTDYYARKRLVTQAKNKYNAPKYRLVVRLTNKDIIVQVVYARIQGDFILTQAHSRELP-RYGIKHGLTNWAAA
NEA10035|Rpl5        -MPFVKVQKNDAYFSRYQVKPRRRRQGKTDYQARRGLVSQAKNKYASPKYRLVVRITNKQVICQIVYAKLQGDVVFAHATSKELP-RYGIKHGLTNWTAC
MAY10035|Rpl5        -MPFVKTVKSNSYFSRYQVKYRRRREGRTDYYARKRLVSQAKNKYNAPKYRLVVRFSNRYVTCQIVHAKIVGDFVLTQASSKELP-RYGVKTGLSNWTAA
RHI10132|Rpl5        -MPFVKQQKNKAYFKRYQVKYRRRREGKTDYYARKRLVVQAKNKYNSPKYRMVVRFTNKDIICQIVYAKLQGDFVLSAAYAHELP-RYGIKGGLTNWAAA
RHI10133|Rpl5-2      -MPFVKQQKNKAYFKRYQVKYRRRREGKTDYYARKRLVVQAKNKYNSPKYRMVVRFTNKDIICQIIYAKLQGDFVLSAAYAHELP-RYGIKGGLTNWAAA
RHI10134|Rpl5-3      -MPFVKQQKNKAYFKRYQVKYRRRREGKTDYYARKRLVVQAKNKYNSPKYRMVVRFTNKDIICQIVYAKLQGDFVLSAAYAHELP-RYGIKGGLTNWAAA
RHI10135|Rpl5-4      -MPFVKQQKNKAYFKRYQVKYRRRREGKTDYYARKRLVVQAKNKYNSPKYRMVVRFTNKDIICQIIYAKLQGDFVLSAAYAHELP-RYGIKGGLTNWAAA
ARA10097|At3g25520   -MVFVKSTKSNAYFKRYQVKFRRRRDGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDIVAQIVSASIAGDIVKASAYAHELP-QYGLTVGLTNYAAA
ARA10098|RPL5B       -MVFVKSSKSNAYFKRYQVKFRRRRDGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDIVAQIVSASIAGDIVKASAYAHELP-QYGLTVGLTNYAAA
RIC10110|RPL5B       MGGFVKTQKTNAYHKRFQVKFKRRRQGKTDYRARIRLTNQDKNKYNTPKYRFVVRFTNKDITAQIVYATIAGDIVMAAAYSHELP-RYGLEVGLTNYAAA
RIC10111|11667.m0675 MGGFVKTQKTHAYFKRFQVKFKRRRQGKTDYRARIRLTNQDKNKYNTPKYRFVVRFTNKDITAQIVYATIAGDIVMAAAYSHELP-RYGLEVGLTNYAAA
GMA10174|LOC10080586 -MVYVKSQKSKAYFKRYQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFSNKDIVAQIISASIAGDIVLAAAYAHELP-RYGLEVGLTNYAAA
GMA10175|LOC10078618 -MVYVKAQKSKAYFKRYQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFSNKDIVAQIISASIAGDLVLATAYSHELP-RYGLEVGLTNYAAA
GMA10176|LOC10078618 -MVYVKAQKSKAYFKRYQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFSNKDIVAQIISASIAGDLVLATAYSHELP-RYGLEVGLTNYAAA
GMA10177|LOC10081881 -MVYVKAQKSKAYFKRYQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFSNKDIVAQIISASIAGDIVLAAAYAHELP-RYGLEVGLTNYAAA
GMA10178|LOC10081774 -MVYVKAQKSKAYFKRYQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFSNKDIVAQIISASIAGDIVLAAAYAHELP-QYGLEVGLTNYAAA
POP10035|RPL5        -MAFAKAQKSRAYFKRYQVKFKRRRAGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDIIAQIASASIAGDIVLASAYAHELP-RYGLEAGLTNYAAA
CRE10035|RPL5        -MGYVKVIKTSPYFSRFQVKYRRRREGKTDYRARLRLVKQDKNKYNTPKYRLVVRFTNRDITCQIVRSTIKGDIVEAAAYAHELP-DYGLECGLTNYAAC
VOL10038|RPL5        -MGYVKVVKTSAYFSRFQVKYRRRREGKTDYRARLRLVKQDKNKYNTPKYRLVVRFSNRDVTCQIVRSTIKGDIVEAAAYAHELP-DYGLKAGLTNYSSC
HEM10032|rpl5        -MSLIKIKKNRSYHSRFQLKWRRRREGKTDYYSRKRLITQDKRKYNSPKYRMVVRITKKNIICQFTQSLLEGDRVLMAGYSNKIGKQLEFFCGPTAFHIA
PTR10037|RPL5        -MPFVKNTKNKAYFSRYQVKFRRRREGRTDYRQRKRLVCQDKNKYQSPKYRLVVRFTNTQVICQIVYSLVDGDRILCQANSKELA-RYGLSVGLKNYAAA
TPS10035|Rpl5        -MTFVKVTKSKAYYKRYQVKFRRRREGRTDYRQRKRLCCQAKNKYQSPKYRFVVRFSNKQVICQIAYTLIDGDRILTSASSNELP-RYGLKVGLKNYAAS
CYA10036|RPL5        -MAFVKVVKNKAYFKRFQVKPRRRREGKTDYHARRALIIVDKTKYNTPKYRLVVRITNSDVICQIVTARVEGDKVIAAAYAHELP-RYGIKVGLTNFAAA
DIC10035|RPL5        -MGFVKVVKTKAYYSRYQVQFRRRREGKTDYQQRHRLITQDKNKYNSPKYRLVARITNTDVIAQVVYSKIVGDFVLCAAYAHELP-RFGVKVGLTNYASC
PLA10039|RPL5        -MAYVKVVKNKAYFKRYQVKYRRRREGKTDYRARKALILQDKNKYNAQKLRFVVRKTNSQVICQIACAHIEGDKILAEAKSKELI-RYGIPVGLKNYAAA
TGO10035|RPL5        -MAFVKALKNKAYFKRYQVKYRRRRQGKTDYAARRALVLQDRNKYNAHKHRLVVRLTNKRIICQVVYSTIEGDRVLATAESTELP-RYGVKIGLTNYAAA
GIA10035|Rpl5        -MGWVKVQKTRSYFKRFQVQFRRRREGKTDYQARKALIIQDKNKYATPRYRFVVRRTNKDIICQVTAAELTKDRVVCAAYSHELP-RYGIPVGLTNYAAA


HUM10036|RPL5        YCTGLLLARRLLNRFGMDKIYEGQVEVTG---------DEYNVESIDG---QPGAFTCYLDAGLARTTTGNKVFGALKGAVDGGLSIPHSTKRFPGYDS-
DOG10035|Rpl5        YCTGLLLARRLLNRFGMDKIYEGQVEVTG---------DEYNVESIDG---QPGAFTCYLDAGLARTTTGNKVFGALKGAVDGGLSIPHSTKRFPGYDS-
MUS10035|Rpl5        YCTGLLLARRLLNRFGMDKIYEGQVEVNG---------GEYNVESIDG---QPGAFTCYLDAGLARTTTGNKVFGALKGAVDGGLSIPHSTKRFPGYDS-
RAT10035|Rpl5        YCTGLLLARRLLNRFGMDKIYEGQVEVNG---------DEYNVESIDG---QPGAFTCYLDAGLARTTTGNKVFGALKGAVDGGLSIPHSTKRFPGYDS-
CHK10036|Rpl5        YCTGLLLARRLLNKFGLDKIYEGQVEVTG---------DEYNVESVDG---KPGAFTCYLDAGLARTTTGNKVFGALKGAVDGGLSIPHSTKRFPGYDS-
FUG10036|RPL5        YCTGLLLARRLLNKFGLDKVYEGQVEVTG---------EEFNVESIDG---QPGAFTCYLDAGLARTTTGNKVFGAVKGAVDGGLSIPHSTKRFPGYDP-
DAN10035|Rpl5        YCTGLLLARRLLNKFGLDKVYDGQVEITG---------DEFNVESIDG---QPGAFTCYLDAGLARTTTGNKVFGALKGAVDGGLSIPHSTKRFPGYDV-
MED10035|Rpl5        YCTGLLLARRLLNKFGLDKVYEGQVEVTG---------DEFNVESIDG---QPGAFTCYLDAGLARTTTGNKVFGALKGAVDGGLSIPHSTKRFPGYDT-
CIO10035|RPL5        YCTGLLLARRLLTKFGLDKIYEGQTEIDG---------DEYNVEDIDG---QPGAFRAFLDIGLARTTTGARIFGAMKGAADGGLDIPHSVKRFPGYDA-
DRO10048|RpL5        YCTGLLVARRVLNKLGLDSLYAGCTEVTG---------EEFNVEPVDD---GPGAFRCFLDVGLARTTTGARVFGAMKGAVDGGLNIPHSVKRFPGYSA-
MOS10035|Rpl5        YCTGLLVARRILQKLRLDTLYAGCTDVTG---------EEYLVEPVDE---GPAAFRCYLDVGLARTTTGARVFGAMKGAVDGGLNIPHSVKRFPGYSA-
BEE10036|Rpl5        YCTGLLLARRLLKKLGLDTLYTGTTEVTG---------DEYNVEELDDE--GPGAFRCYLDTGLMRTTTGARVFGAMKGAVDGGLNIPHSTKRFPGYDS-
CEL10035|rpl-5       YATGLLLARRHLKTIGLDSTYKGHEELTG---------EDYNVE-EEGD--R-APFKAVLDIGLARTTTGSKIFAVMKGVADGGINVPHSESRFFGFDQ-
BMA10035|RPL5        YATGLLLARRHLLNIGLAEAYKGVEEATG---------DDYNVE-KEGE--R-APFRAVLDVGLARTVTGAKVFAVMKGVADGGIDVPHSETRFFGYNS-
STE10035|RPL5        YCTGLLLARRLLTKLNLHEIYTGTEEVNG---------DEYNVESIDG---SPGAFRCFLDVGLARTSTGARVFGALKGAVDGGLEIPHSMKRFPGYDS-
MBR10035|RPL5        YATGLLVARRLLTKLNLADTYKGVEEPNG---------EDYFVEEAED---KPRPFRCYLDVGLAPTTTGSRVFGVMKGAVDGGLAIPHNHKRFPGYDA-
NEU10036|Rpl5        YATGLLLARRVLKKLGLDETFKGVEEADG---------EYKLTEAAETDDGERRPFKAFLDVGLARTSTGARVFGAMKGASDGGIFIPHSENRFPGYDM-
GRI10035|Rpl5        YATGLLIARRVLKKLGLDEDFTGVEEPEG---------EFTLTEAAETDEGTRRPFKAYLDVGLARTSTGARVFGAMKGASDGGILIPHSENRFPGFDI-
GRA10036|Rpl5        YATGLLVARRALKKLGLDEDFAGVEEADG---------EYKLTEAAETDDGERRPFKVFLDVGLKRTSTGARVFGAMKGASDGGILVPHSEKRFPGYDM-
STA10035|Rpl5        YATGLLLARRTLKKLEMDEDFVGVEEADG---------EFTLTEAAEVDGEERRPFKVFLDVGLVRTSTGARVFGAMKGCSDGGVFIPHSENRFPGYDI-
YAR10036|Rpl5        YAVGLLVARRALKKLGLDETYKGVEEVEG---------EFELTEAVEDGP---RPFKVFLDVGMTRTTTGAKCFGVLKGASDGGLYVPHSASRFPGWDI-
POM10060|RPL5-1      YATGLLVARRALAKVGLADKYEGVTEPEG---------EFELTEAIEDG---PRPFKVFLDVGLKRTSTGSRVFGAMKGASDGGLFIPHSPNRFPGFDI-
POM10061|RPL5-2      YATGLLVARRALAKVGLADKYEGVTEPEG---------EFELTEAIEDG---PRPFKVFLDVGLKRTSTGSRVFGAMKGASDGGLFIPHSPNRFPGFDI-
YST10060|RPL5        YATGLLIARRTLQKLGLDETYKGVEEVEG---------EYELTEAVEDGP---RPFKVFLDIGLQRTTTGARVFGALKGASDGGLYVPHSENRFPGWDF-
CIN10035|Rpl5        YATGLLAARRALTKLGLADKYEGVTEPDG---------TLQITEALDDDD-APRPFKAFLDVGLRRTSTGARVFGAMKGASDGGIYIPHSEKRFPGYDP-
NEA10035|Rpl5        YATGLLVARRALTKLGLADKYEGVVEPTG---------ELQLIEPLGDD--EPRPFKCYLDVGLRRTSTGARVFGAMKGASDGGIFIPHNEKRFPGYDP-
MAY10035|Rpl5        YATGLLVARRALTLLGLADKYEGVTEPDG---------EMAEVEPLGDD--EPRPFKCFLDVGLKRTSTGSRVFGALKGASDGGIFIPHSEKRFPGFDP-
RHI10132|Rpl5        YATGLLLARRTLTKLGLADKYEGFAEPDG---------TVQMIEAAEGAP---RPFKAFLDVGLARTSTGARVFGAMKGASDGGIYIPHSGNRFPGFDI-
RHI10133|Rpl5-2      YATGLLLARRTLTKLGLADKYEGFAEPDG---------TVQMIEAAEGAP---RPFKAFLDVGLARTSTGARVFGAMKGASDGGIYIPHSGNRFPGFDI-
RHI10134|Rpl5-3      YATGLLLARRTLTKLGLADKYEGFAEPDG---------TVQMIEAAEGAP---RPFKAFLDVGLARTSTGARVFGAMKGASDGGIYIPHSGNRFPGFDI-
RHI10135|Rpl5-4      YATGLLLARRTLTKLGLADKYEGFAEPDG---------TVQMIEAAEGAP---RPFKAFLDVGLARTSTGARVFGAMKGASDGGIYIPHSGNRFPGFDI-
ARA10097|At3g25520   YCTGLLLARRVLKMLEMDDEYEGNVEATG---------EDFSVEPTDSR----RPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFHK-
ARA10098|RPL5B       YCTGLLLARRVLKMLEMDDEYEGNVEATG---------EDFSVEPTDSR----RPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFHK-
RIC10110|RPL5B       YCTGLLLARRVLKLRGLDQEYEGNIEATG---------EDYYVEPADER----RPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFKK-
RIC10111|11667.m0675 YCTGLLLARRVLTLRGLDQEYEGNVEATG---------EDYYVEPADER----RPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFKK-
GMA10174|LOC10080586 YCTGLLLARRVLKTLEMDEEYEGNVEATG---------EDYSVEPAESR----RPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFDK-
GMA10175|LOC10078618 YCTGLLLARRVLKTLEMDEEYEGNVEATG---------EDYSVEPAESR----RPFRALLDVGLVRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFDK-
GMA10176|LOC10078618 YCTGLLLARRVLKTLEMDEEYEGNVEATG---------EDYSVEPAESR----RPFRALLDVGLVRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFDK-
GMA10177|LOC10081881 YCTGLLLARRVLKTLEMDEEYEGNVEATG---------EDYSVEPAESR----RPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFDK-
GMA10178|LOC10081774 YCTGLLLARRVLNTLEMDEEYEGNVEATG---------EDYSVEPAESR----RPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFDK-
POP10035|RPL5        YCTGLLLARRVLKMLEMDDEYEGNVEATG---------EDFSVEPADSR----RPFRALLDVGLLRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFAK-
CRE10035|RPL5        YCVGLLVARRILTKFGLDKHYPGQTEPDG---------EDYNIEPVEEGP---RPFFCLLDTGLKRTSTGSKVFGCLKGALDGGLDIPHNEKRLVGYDR-
VOL10038|RPL5        YCVGLLVARRILTKFNLAEHYPGQEEPDG---------EDFNVDPVEDGP---RPFYCLLDTGLKRTSTGSKVFACLKGALDGGLDIPHNEKRFVGYDR-
HEM10032|rpl5        YFCGVYLANRILFKKENKNSETPNVRKKY-----------------------AKSIFAILDIGLTRATTGHRVFAAMKGALDGGITIPYNEKRFPGYNS-
PTR10037|RPL5        YCTGLLAARRLLQKVGLDDVYEGNSEVDATIVSTEYDKKKYFVDEVDEDK---RPFRCLLDVGCKPTTTGHRVFGALKGAADGGLDIPHSEKRFPGFDR-
TPS10035|Rpl5        YCTGLLCARRLLQKVGLDDVYEGNDEIDGNVVKTQVGKSTYYVDEVDEDK---RPFRALLDVGCKTTTTGCRIFGALKGAADGGLDIPHSEKRFPGYDR-
CYA10036|RPL5        YATGLLVARRTLTILGLADAYQGKVEADG---------ELYQVEPVGETR----PFRAVLDVGLVRTTTGHRVFAAMKGAVDGGIDIPHSEKRFPKYK--
DIC10035|RPL5        YATGLLLARRLLAKLKLADLYKGAEKVDG---------KVFLVK-PVDD--KPRPFKANLDVGLARTSTGAKVFAVLKGAVDGGIYVPHGETRFAGYNA-
PLA10039|RPL5        YATGLLCARRFLKSLNLDTQFLGVEKVTG----------EIENNEDKEDEEGRKPIKAFLDVGITRTTTGNRVFAALKGACDGGLNIPHGNNRFPGS---
TGO10035|RPL5        YCTGLLLARRVLKQLGMSETFEGVEATGE----------EYHIEENFGE---RRPFKVLLDVGIVRTTVGNRVFGAMKGAADGGLHVPHGIKKFPGYSKP
GIA10035|Rpl5        YATGLLCGRRLLEKLSVGIKENALAQLYPG----LDKATGEEYHPDENENEEVHAFKAFLDIGLARASTGARVFAAMKGAVDAGLNIPHSMKRFPGYSK-


HUM10036|RPL5        ---ESKEFNAEVHRKHIMGQNVADYMRYLMEEDEDAYKKQFSQYIKNSVTPDMMEEMYKKAHAAIRENPVYEK-----------KPKKE--VKKKRWNRP
DOG10035|Rpl5        ---ESKEFNAEVHRKHIMGQNVADYMRYLMEEDEDAYKKQFSQYIKNNVTPDMMEEMYKKAHAAIRENPVYEK-----------KPKKE--VKKKRWNRP
MUS10035|Rpl5        ---ESKEFNAEVHRKHIMGQNVADYMRYLMEEDEDAYKKQFSQYIKNNVTPDMMEEMYKKAHAAIRENPVYEK-----------KPKRE--VKKKRWNRP
RAT10035|Rpl5        ---ESKEFNAEVHRKHIMGQNVADYMRYLMEEDEDAYKKQFSQYIKNNVTPDMMEEMYKKAHAAIRENPVYEK-----------KPKRE--VKKKRWNRP
CHK10036|Rpl5        ---ESKEFNAEVHRKHIMGQNVADYMRYLMEEDEDAYKKQFSQYIKNNITPDGMEEMYKKAHAAIRDNPVHEK-----------KPKRE--VKKKRVNST
FUG10036|RPL5        ---ESKEFNAEAHRKHIMGINVSEYMSYLMEEDEDTYKKQFSRFIKNGVTPDMIEEMYKKAHASIRENPVHEK-----------KPPKE--VKKKRWNRA
DAN10035|Rpl5        ---ESKEFNAEVHRKHILGLNIAEYMRLLMEEDEECYKKQFSRFIKNGVTADSMEEMYKKAHAAIRENPVHEK-----------KPKRE--VKKKRWNRA
MED10035|Rpl5        ---ESKEFNAEVHRKHIMGVNVAEYMRYLMEEDEEAYKKQFSRFIKNGVNPDMMEDMYKKAHASIRENPVHEK-----------KPPKE--FVKKRWNRA
CIO10035|RPL5        ---ESKEFNAEVHRNHIFGQHVSEYMTSLEESDEDAFKRQFSQYIKNGITADGVEEMYKKAHASIREDPTPKA-----------KVEKQ--VPKKRWNRA
DRO10048|RpL5        ---ETKSFNADVHRAHIFGQHVADYMRSLEEEDEESFKRQFSRYIKLGIRADDLEDIYKKAHQAIRNDPTHKV-----------TAKKSSAVTKKRWNAK
MOS10035|Rpl5        ---ENKSFNAEMHRDHIFGLHVANYMRTLEEEDEEAFKRQFSKYISLGIKADDIENIYKNAHASIRKDPSFTK-----------KPEK--KVTKKRWTMA
BEE10036|Rpl5        ---ESKSFNADVHRQHIFGQHVANYMKTLEEDDDEAFKRQFSQYIKNGITADSIESIYKNAHEAIRANPEHTK-----------VIKEK-VPMKKRWNRA
CEL10035|rpl-5       ---ESKEYNAEAHRDRILGKHVADYMTYLKEEDEDRYKRQFSKFLAAGLNADNLVATYQKVHSAIRADASPAA-----------KKAAKP--SKR-HTAK
BMA10035|RPL5        ---ETK-YNAEAHRDRILGKHVADYMALLKEQDEDAYKQHFSRFIAANISADDIVDMYKKAHEAIRKNPAREP-----------KEPKEV--TKKRWTAK
STE10035|RPL5        ---ESKDFSAEVHRNHIFGQHVANYMRQLAEDDEEAFKRQFSLYIKHGIEADGIEAMYKKAHAAIRESPEAKP-----------AAKRE--VTVKRFHRK
MBR10035|RPL5        ---EAKEMDAEVVRDYIFGEHVANYMRELQDEDDEAFRKQFAKYIKLGVGADDIEDMITEAHEKIRENPIIPK-----------KSQEG--KEHKSYKKI
NEU10036|Rpl5        ---ESEELDAETLKKYIFGGHVAEYMETLADDDEERYKSQFNRYIEDDLEADGLEDLYAEAHAAIREDPFKKAE-----SEAPKKTKEEWKAESLKYKKS
GRI10035|Rpl5        ---ESKELDSETLKKYIFGGHVAEYMETLADDDEERYKSQFQQYIDEDIDADGLEDIYTEAHAAIREDPFKKPE-----GAEAKKSKEEYKKESLKFKAK
GRA10036|Rpl5        ---ETKELDADTLRNYIFGGHVAEYMETLADDDEERFRSQFQKYVDDDVEAEGLEDLYTEAHAAIREDPFKKVE-----SDAPKKTKEEWKEISQKYKSK
STA10035|Rpl5        ---EGKELDAETLRKYIFAGHVAEYMETLADDDEERYKSQFSGYIDDDLEADGLEELYQDAHKQIREDPWKKEE-----SDN-KKTKEEWKAESKKYRSV
YAR10036|Rpl5        ---ESEELDSETLRKYIFAGHVSEYMEELADDDEERFRQIFQSYLDDEVDADSVEEILQAAHEQIRADPDHKP-------TAKKT-KAEYAAESKKYKQK
POM10060|RPL5-1      ---ETEELDDETLRKYIYGGHVAEYMEMLIDDDEERYQKQFSGLIADGIESDQLEDIYAEAYAKIREDPSFQK---------SGKDAAAFKAESLKHTQR
POM10061|RPL5-2      ---ETEELDDETLRKYIYGGHVAEYMEMLIDDDEERYQKQFSGLIADGIESDQLEDIYAEAYAKIREDPSFQK---------SGKDAAAFKAESLKYTQR
YST10060|RPL5        ---ETEEIDPELLRSYIFGGHVSQYMEELADDDEERFSELFKGYLADDIDADSLEDIYTSAHEAIRADPAFKP-------TEKKFTKEQYAAESKKYRQT
CIN10035|Rpl5        ---ESKSLDAEVLQKYIYGGHVAEYMESLEEEDDERFKKQFASYLADDIGSDDIEDIYKNAHAAIRADPTFKP---------TTK-TKDWKAESLKYKVP
NEA10035|Rpl5        ---ESKELDAEVLQKYIVGGHVAEYMESLEEEDDERFKKQFSSYLADGVGSDDIEEIYTNAYEAIREDPTFKP---------TEKDVAKWKAESLKYKTF
MAY10035|Rpl5        ---EAKELDAELLRSYIYGGHVAEYMESLEEEDDERFKKQFSTALEQDIGSEDLEDMWTEAFEKIREDPSFTP---------SDKSGKDWAAESKKYKAT
RHI10132|Rpl5        ---ETKTNDDELLRNYIFGIHVAEYMEYLEEEDEERYKKQFATFIKEGITSDAVEDMYAEAHAAIRENP-------------LPQITEKKKSGTLHKKPA
RHI10133|Rpl5-2      ---ETKTNDDELLRNYIFGIHVAEYMEYLEEEDEERYKKQFATFIKQGITSDAVEDMYAEAHAAIRENP-------------LPQITEKKKSGTLHKKPA
RHI10134|Rpl5-3      ---ETKTNDDELLRNYIFGIHVAEYMEYLEEEDEERYKKQFATFIKEGITSDAVEDMYAEAHAAIRENP-------------LPQITEKKKSGTLHKKPA
RHI10135|Rpl5-4      ---ETKTNDDELLRNYIFGIHVAEYMEYLEEEDEERYKKQFATFIKEGITSDAVEDMYAEAHAAIRENP-------------LPQITEKKKSGTLHKKPA
ARA10097|At3g25520   ---ENKQLDAEIHRNYIYGGHVSNYMKLLGEDEPEKLQTHFSAYIKKGVEAESIEELYKKVHAAIRADPNPKK------------TVKPAPKQHKRYNLK
ARA10098|RPL5B       ---ENKQLDAEIHRNYIYGGHVSNYMKLLGEDEPEKLQTHFSAYIKKGVEAESIEEMYKKVHAAIRAEPNHKK------------TEKSAPKEHKRYNLK
RIC10110|RPL5B       ---DEKQLDSDIHRKYIYGGHVADYMRSMAEEEPEKFQAHFSEYLKKGIDADGMEALYKKVHAAIRADPTMAK------------STKKEPATHKRYNLK
RIC10111|11667.m0675 ---DEKQLDSDIHRKYIYGGHVADYMRSMAEEEPEKFQAHFSEYLKKGIDADGMESLYKKVHAAIRADPTMAK------------STKKEPATHKRYNLK
GMA10174|LOC10080586 ---EKKELDAEVHRKYVFGGHVAAYMKILAEDEPEKYQSHFSEYIKRGIEADGIEALYKKVHAAIRADPSLKK------------SEKQPPKEHKRYNLK
GMA10175|LOC10078618 ---EKKELDAEVHRKYVFGGHVAAYMKILAEDEPEKYQSHFSEYIKRGIEADGIEALYKKVHAAIRADPTLRK------------SDKQPPKEHKRYNMK
GMA10176|LOC10078618 ---EKKELDAEVHRKYVFGGHVAAYMKILAEDEPEKYQSHFSEYIKRGIEADGIEALYKKVHAAIRADPTLRK------------SDKEPPKEHKRYNMK
GMA10177|LOC10081881 ---EKKELDAEVHRKYVFGGHVAAYMKILAEDEPEKYQSHFSEYIKRGIEADGIEALYKNVHAAIRADPTLKK------------SDKQTPKEHKRYNLK
GMA10178|LOC10081774 ---EKKELDAEVHRKYVFGGHVAAYMKILAEDEPEKYQSHFSEYIKRGIEADGIEALYKKVHAAIRADPTLKK------------SDKQPPKEHKRYNLK
POP10035|RPL5        ---DNKQLDAEVHRKYIYGGHVAAYMRTLMEDEPEKYQSHFSEYLKRGIDADGMEALYKKVHAAIRADPTAKK------------SEKQPPKEHKRYNLK
CRE10035|RPL5        ---SGKKMDAEVLKKYIFGGHVAEYMEEMEEEEPEKYMKHFAKYVEADLSGGDLEDKYAEVHAAIREKPVKEK------------AARTKPAAAKRWHTP
VOL10038|RPL5        ---SSKKFDPEIMKKYIFGGHVAEYMEEMEEEEPEKYTKHFSKFLEEDISGGDLEDLYAEVHKNIRENPVKEK------------KPRTKPATQERWHEQ
HEM10032|rpl5        ----KDGFTPENFIYRALGLHVRDYVTKLKEEDEEKYQIEFGTRIKKNENNLYFENTPEIKNIQDQINKIMSEN-------------------------Y
PTR10037|RPL5        ---DSKEYDADMHRERIFGGHVGEYMEYLEEEDNQKYQEHFASFIAAEVEADGLEELYESVHEKIREDPSPSP------------KKDFSPDKSFKR-KA
TPS10035|Rpl5        ---DSKEYDADMHRERIFGGHVGEYMEYLEEEDNTKYQAQFAGYLENEVEADGLEELYESVHEKIREDPSPSE------------KKAFSPDKSFKR-KA
CYA10036|RPL5        ---KGSEFDPEELKARIYGNHVADYMRMLREEDPEKYQRQFSRYIQAGIDPDQLEDMYREAHRRIREDPRAVLT-------------DKSRVTKRPRKTP
DIC10035|RPL5        ---ESKKLNAETLRGYIFGKHVASYMTLLQTEDEDAYKKIFSQYIKNGVAPKDIETIYANAHKAIRANPAPAA-----------KSTKS--------YKD
PLA10039|RPL5        ----KNEFNPEQLRKNILGIHVAEYMKTLQEEDNDKYKTHFNDYLKNNIGADDIEQMYLNAHEKIRQNPEKESKDTKN----------VKKFVSKHEKPK
TGO10035|RPL5        EGEGEGSYDPEAHRARILGLHVADYMRQLKEEDPEKYSAQFSQYIKNKIEADDIEAMYKNAHAQIRKNPDAVKKERAANVQNVRQGNVIKTAKGQYVRHV
GIA10035|Rpl5        -----DGFDSSALRDRIMGKHVGDYMAELKAEDEETYRKRFSKYIAAKVEPLRLEAMYTKAHAAIRANPQAVK---------------AKFEIKKPVRQA


HUM10036|RPL5        KMSLAQKKDRVAQKKASFLRAQERAAES------
DOG10035|Rpl5        KMSLAQKKDRVAQKKASFLRAQERAAES------
MUS10035|Rpl5        KMSLAQKKDRVAQKKASFLRAQERAAES------
RAT10035|Rpl5        KMSLAQKKDRVAQKKASFLRAQERAAES------
CHK10036|Rpl5        KMSLAQKKDRVAQKKASFLRAQERAADS------
FUG10036|RPL5        KLSLAQRKDRVAQKKASFLRAQEQEASD------
DAN10035|Rpl5        KLTLAQRKDRVAQKKASFLRAQAAEED-------
MED10035|Rpl5        KLSLAQKKDRVAQKKASFLRAQEQEAAD------
CIO10035|RPL5        KLTKSQREDRVRQKKASYLRAIGAGDN-------
DRO10048|RpL5        KLTNEQRKTKIAAHKAAYVAKLQSETEA------
MOS10035|Rpl5        KLPLAARKEKIAKHKADFLAKIQADVEA------
BEE10036|Rpl5        KLSLSERKNRVAQKKASFLKTLEEVEA-------
CEL10035|rpl-5       RLTYDERKQRVADKKALLLQLKEQQE--------
BMA10035|RPL5        KGSLAVRKNRVKNKKAYLKMLKAQQEAQ------
STE10035|RPL5        KMSRQQRVDRVKQKKAAFLRAQGEDDD-------
MBR10035|RPL5        PLSYAQRKDRIKQKKESFRKKLAAEADA------
NEU10036|Rpl5        KLTREQRAAGVQERIAALRSE-------------
GRI10035|Rpl5        KLTLAERKARVQERIAELRDAE------------
GRA10036|Rpl5        KLTKEEKEKRVQERIQEIMQRD------------
STA10035|Rpl5        KLSKAEKEERVQRKIAELKA--------------
YAR10036|Rpl5        KLTKAERDARVQAKIQEIRAQQ------------
POM10060|RPL5-1      KLTAEERKERFNAKVIEAGRA-------------
POM10061|RPL5-2      KLTAEERKERFNAKVIEAGRA-------------
YST10060|RPL5        KLSKEERAARVAAKIAALAGQQ------------
CIN10035|Rpl5        RLTLEQRKERIAEKIAKFQAGGFDEDDE------
NEA10035|Rpl5        KLTKEQKQERVQAKIAAYKAGKLDVEEDEE----
MAY10035|Rpl5        KLTYEQRKAKIADKIAAFKAGAEL----------
RHI10132|Rpl5        RLTKKERLAKINAAKAAFEAEN------------
RHI10133|Rpl5-2      RLTKKERLAKINAAKAAFEAEN------------
RHI10134|Rpl5-3      RLTKKERLAKINAAKAAFEAEQ------------
RHI10135|Rpl5-4      RLTKKERLAKINAAKAAFEAEQ------------
ARA10097|At3g25520   KLTYEERKNKLIERVKALNGAGGDDDDEDDEE--
ARA10098|RPL5B       KLTYEERKNKLIERVKALNGAGGDDDDEDDEE--
RIC10110|RPL5B       KLTYEQRKASLVERLNALNSSAGADDDDEEEDDE
RIC10111|11667.m0675 KLTYEQRKASLVERLNALNSSAGADDDDEEEDDE
GMA10174|LOC10080586 KLTYEERKAKLIARVAAINSAADNDEDDE-----
GMA10175|LOC10078618 KLTYEERKAKLVARVAAINSAADNDEDDE-----
GMA10176|LOC10078618 KLTYEERKAKLIARVAAINSAADSDEDDE-----
GMA10177|LOC10081881 KLTYEERKAKLISRVAALNSAADNDEDDE-----
GMA10178|LOC10081774 KLTYEERKAKLIARVASLNSAADNDEDDE-----
POP10035|RPL5        KLTYEERKAKLVERLNALNSAADDEDDE------
CRE10035|RPL5        KLTLEQRRENLKQKLAALQDDEE-----------
VOL10038|RPL5        KLTLEQRRENLKQKLATLMDDDE-----------
HEM10032|rpl5        KNCFQNMTKKVGFEKS------------------
PTR10037|RPL5        KLTLDERKARVQAKKDAKNAELAADDE-------
TPS10035|Rpl5        KLTLEERKAAVQSKKDTKNAELEAEDED------
CYA10036|RPL5        KLSREEKQARLAARLAALARSGATESMVTVS---
DIC10035|RPL5        IKSKNLSKRTLKQKKARVASIKASYKARL-----
PLA10039|RPL5        KLNAKLRKKRVKEKLALYVEKLQ-----------
TGO10035|RPL5        KLTKAQRRERVQQKVRGEGEEIQGL---------
GIA10035|Rpl5        RLTLKERKERIDAKKLEALKQLTK----------