CLUSTAL W (2.1) Multiple Sequence Alignments
HUM10037|RPL6        -MAGEKVEKPDTKEKKPEAKKVD---------AGGKVKKGNLKAKKPKKGKPHCSRNPVLVRGIGRYSRSAMYSRKAMYKRKYSAAKSKVEKKKK-EKVL
DOG10036|Rpl6        -MAGEKAEKPDTKEKKPEAKKVN---------AGGKAKKGNLKAKTPKKGKPHCSRNPVLVRGIGRYSRSAMYSRKAMYKRKYSAAKSRVEKKKK-EKVL
MUS10036|Rpl6        ---MAGEKAPDTKEKKPAAKKAGSDAAASRPRAAKVAKKVHPKGKKPKKAKPHCSRNPVLVRGIGRYSRSAMYSRKALYKRKYSAAKTKVEKKKKKEKVL
RAT10036|Rpl6        -MAGEKAEKPDKKEQKPAAKKAGGDATAPRALPAGAVKKSSSKAKKLRKSKPHCSRNPVLVRGIGRYSRSAMYSRKALYKRKYSAAKTKVEKKKKKEKVL
CHK10037|Rpl6        MAGEKKAGEKKAGEKKPAQKKVGEKKPADKKPVEKKAGQKKVREKIKKPKKYHASRNPVLARGIGKYSRSAMYARKALYKRKYTAPETKIEKKKKEK---
FUG10037|RPL6        ----------------------------------------MAEGDKKSAKKRHRSRNPVLARGIGRYSRSAMYARKAMYKRKTKTTETKVEKKIKEK---
DAN10036|Rpl6        ----------------------------------------MAEGDKKKVARKHGSRNPELVRGIGRYSRSAMFARRAMYKRKTKAPVTKVEKKIKEKKVK
MED10036|Rpl6        ----------------------------------------MAEGDKKPAKKKHGSRNPVLARGIGRYSRSAMFARRAMYKRKTKTTETKVEKKIKIKER-
CIO10036|RPL6        -----------------------------------------------MAKKPHAPRNKPLRKGVNRYSRSVMYAKRYAFKHRKNVTKVEKKMDVTHK---
DRO10049|RpL6        --------------------------------MAPIEKAKKVAKSAKKGKKHPVN--SYLKGGILRYSKAQMYKRRALYRLKDKKSPVVEKAKVPIK---
MOS10036|Rpl6        ------------------------MAPKETKAAAPAKAVKKVRKAPKKVQKVSKYPASLLTAGLYRAVRSRMVKTRLPLSAKT-VDPAKVKPKKPVT---
BEE10037|Rpl6-1      -------------------MTDTKETNETKLKSPEKKEISSVKKGEKKGRIRPRN--YDLGNGVYRFSRTRMFHKKAIYKFLSKKTPKSVKPKKPIT---
CEL10036|rpl-6       ------------------------------------------MVGKRNLPVISRN--FDLSPGVLRFSASRLRLKKGEKKPKFTKDTSAKLPKLQRN---
BMA10036|RPL6        ------------------------------------------MLAKKRVPRMRHN--YEVAPGVMRFSAARMYAKRGAYAKKTYPTVEKKMRRKVKF---
STE10036|RPL6        ---------------------------------------------MPAKSKDHPSRNPELAPGISRYSRSAIYKKRALYKRKKTGVKKVVQDEPR-----
MBR10036|RPL6        -------------------------------------------------MAKGDVRNEMLSKGVERYGRSAMYKRRLMFKRNKVQVAKKSVEKPTTKEVK
NEU10037|Rpl6        -------------------------------------------------------------------------------MSSAAAPQTKTFGKATRTVPH
GRI10036|Rpl6        -------------------------------------------------------------------------------MSTKTEPTQKQFGKASRTVPH
GRA10037|Rpl6        ---------------------------------------------------------------------------------MSAKPTSKTFGKSTREVPA
STA10036|Rpl6        --------------------------------------------------------------------------------------------MAANKEEQ
YAR10037|Rpl6        ----------------------------------------------------------------------------------MSKQIGGAKNGGSRTVP-
POM10062|RPL6        ---------------------------------------------------------------------------------MSTVKVNGAKNGGERMVLP
YST10061|RPL6A       -------------------------------------------------------------------------------------------------MS-
YST10062|RPL6B       -------------------------------------------------------------------------------------------------MT-
CIN10036|Rpl6        --------------------------------------MARSKELVPGVGRLSRSQVFAKRGLFKG-QKKSEKPAAETPAEYVEKTIGGEKNGGKRLVP-
NEA10036|Rpl6        --------------------------------------MARSKPLAPHVGRLSRSQVAAKRGLFKG-QKAGAAPAKTETPAFTEKKVGGKANGEKRLVP-
MAY10036|Rpl6        ---------------------------------------MARHQVAPNVARLGRTKAFQKKGGYKFTQRQGAPKKQEETPAHKEVAVKGAKNGGKRLVP-
RHI10136|Rpl6        -----------------------------------MSHAPRNSFIASGVSRYSRSVAYSKKALYKR-QKTTVAAPAKETVAEKTVEVKGAKNGGKRTVP-
RHI10137|Rpl6-2      -----------------------------------MAHAPRNSVLVPGVSRYSRSTVYSKKALYKR-QKTNVAAPAKQTVAEKTVEVKGAKNGGKRTVP-
RHI10138|Rpl6-3      -----------------------------------MSHAPRNSFIAPGVSRYSRSVAYSKKALYKR-QKSTVAAPVKETAAEKTVEVKGAKNGGKRTVP-
RHI10139|Rpl6-4      -----------------------------------MAHAPRNSVLVPGVSRYSRSAVYSKKALYKR-QKTNVAAPAKQTVAEKTVEVKGAKNGGKRTVP-
ARA10099|RPL6A       --------------------------------------------MPAAKRTPKVNRNPDLIRGVGKYSRSQMYHKRGLWAIKAKNGGVFPRHDAQPKVDA
ARA10100|RPL6B       --------------------------------------------MPAKQRTAKVNRNPDLIRGVGKYSRSQMYHKRGLWAIKAKNGGVFPRHDAKSKVDA
ARA10101|RPL6C       --------------------------------------------MPAKQRTPKVNRNPDLIRGVGKYSRSQMYHKRGLWAIKAKNGGVFPRHDAKSKVDA
RIC10112|RPL6C       -----------------------------------------------------MAPTSKLSQGIKKASRSHTYHRRGLWAIKAKHGGAFPKAEKP--AAA
GMA10179|LOC10078410 ---------------------------------------------MAPKKPRTTTRNPDLVRGIGKYSRSQMYHKRGIWAIKAKNGGVLPRHDPKPKPEA
GMA10180|LOC10080934 ---------------------------------------------MAPKITRKVSRNPELIRGIGKYSRSQMYHKRGIWAIKAKNGGVLPRHDPKPKPEA
GMA10181|LOC10078535 ---------------------------------------------MAPKITRKVSRNPELIRGIGKYSRSQMYHKRGIWAIKAKNGGVLPRHDPKPKPET
GMA10182|LOC10080934 ---------------------------------------------MAPKVTRKVSRNPELIRGIGKYSRSQMYHKRGIWAIKAKNGGVLPRHDPKPKPET
GMA10183|LOC10081172 ---------------------------------------------MAPKKPRTTSRNPDLVRGIGKYSRSQMYHKRGIWAIKAKNGGVLPLHDPKPKPEA
GMA10184|LOC10050002 ---------------------------------------------MAPKITRKVSRNPELIRGIGKYSRSQMYHKRGIWAIKAKNGGVLPRHGPKPKPET
POP10036|RPL6        ---------------------------------------------MAPRKTPQVSRNPDLVRGIGKYSRSQMYHKRGLWAIKAKNGGVFPKHAPKVKDAA
CRE10036|RPL6        ----------------------------------------------------MAKPATFVARGITAEGRAKTYKRKGLWAIKKKNGGKFPAPAKKAVAKQ
VOL10039|RPL6        ----------------------------------------------------MAKPAKFIARGITAEGRSKTYKRKGLWAIKKKNGGKFPTHAKKAAPAQ
HEM10033|rpl6B       ------------------------------------------------------------MLKQKLTEKKNFWANSAIQKINLTNKKLTQLINFKKLSPR
PTR10038|RPL6        ----------------------------------------------------------------MTAAATCSFSHFVVCLPS--------------CSNE
TPS10036|Rpl6        ----------------------------------------------------------------MILLHAVVLTHCSSSHPSPQRVLGTAGPKKAAKAAP
CYA10037|RPL6        ---------------------------------------------------------MSVFTKGSSERAERDAALQAAIKEQAAIISGTGNVIELKPSER
DIC10036|RPL6        ----------------------------------------------MALDNKFVAKGLRLYSARSVANRTKTFVAKKNKVVAPKKVVAPVTPVEKTFGKG
PLA10040|RPL6        -----------------------------------------------------MTNTSNELKHYNVKGKKKVLVPVNAKKTINKKYFGRKVASKKKYVVQ
TGO10036|RPL6        ------------------------------------------------------------------------------------MAPTAAALAKKRLRTR


HUM10037|RPL6        A------TVTKPVGGDKNGGTRVVKLRKMPRYYPTEDVPRKLLSHGKKPFSQHVRKLRASITPGTILIILTGRHRGKRVVFLKQLAS-GLLLVTGPLVLN
DOG10036|Rpl6        A------TVTKPVGGDKNGGTRVVKLRKMPRYYPTEDVPRKLLSHGKKPFSQHVRKLRASITPGTILIILTGRHRGKRVVFLKQLSS-GLLLVTGPLALN
MUS10036|Rpl6        A------TVTKTVGGDKNGGTRVVKLRKMPRYYPTEDVPRKLLSHGKKPFSQHVRRLRSSITPGTVLIILTGRHRGKRVVFLKQLDS-GLLLVTGPLVIN
RAT10036|Rpl6        A------TVTKTVGGDKNGGTRVVKLRKMPRYYPTEDVPRKLLSHGKKPFSQHVRRLRSSITPGTVLIILTGRHRGKRVVFLKQLGS-GLLLVTGPLALN
CHK10037|Rpl6        ----PRATIIKPVGGDKNGGSRVVKVRKMPRYYPTEDVPRKLLSHGKKPFSQHKRRLRASITPGTVLILLTGRHRGKRVVFLKQLGT-GLLLVTGPLAVN
FUG10037|RPL6        ----PRATITKTVGGDKNGGTRVVKLRKMPRYYPTEDVPRKLRSHGKKPFSQHKRRLRSSITPGTVLILLTGRHRGKRVVFLKQLSS-GLLLVTGPLALN
DAN10036|Rpl6        QKSKNPTTAIKTVGGDKNGGTRVVKLRKMPRYYPTEDVRRKLRSHGIKAFSQHRRKLRKTITPGTVLIMLTGRHRGKRVVFLKQLDS-GLLLVTGPLAIN
MED10036|Rpl6        ----PRATVVKTVGGDKNGGTRVVKLRKMPRYYPTEDVPRKLKSHGKKPFCQHKRKLRASITPGTVLILLTGRHRGKRVVFLKQLSS-GLLLVTGPLALN
CIO10036|RPL6        ---------LKTIGGDKNGSTRFVPTKKMPRYYPTEDVPRKLRSHGKKPFSEHKRKLRSSITPGTVLILLAGPHRGKRVVFLKQLDT-GLLLVTGPHKLN
DRO10049|RpL6        --------KVKKIGGPKNGGERTVFLKKSKASYPTKTFVKKRP--SKANFSEHKRNTRRNLTPGTVLILLAGRHQGKRVVLLKVLAS-GLLLVTGPFALN
MOS10036|Rpl6        --------IVKKIGGAKNGGERTVLLRKNKANLPTKRFAHKRP--AKRCFRNHKRNIRKSLKPGKVLILLAGRHKGKRVVLLKTLKT-GLLLVTGPFQLN
BEE10037|Rpl6-1      --------IEKKISGDKNGEKRIVLLKKRRANYPTADPVTVHH--AKKCFRDHRRYLRPSLKPGTICILLAGAHKGKRVVFLKQLKS-GLLLITGPFLIN
CEL10036|rpl-6       --------GTKFALG-----------------------------------HSKTVTLRKTLTPGTVLIVLAGRHKGKRVVFLKQLPQSGLLLVTGPHKIN
BMA10036|RPL6        --------VVKPIGGDKNGKERKVLIKKEPKYLKECRTTR------RTKRSPKKTALRRSITPGTILIILAGRHKGKRVIFLKQLEKSGLLLVTGPMKLN
STE10036|RPL6        -------TKTKDIGGDKNGGKRVVPVQRESRYYPTEDVRRRLANRKK----PGMAKLRSSITPGTVLILLAGAHRGKRVVFLKQLNS-GLLLVTGPFKIN
MBR10036|RPL6        FG----------------KSTRTVPLERQSRFYPAEDIKKPLP----SRKKPGFNKLRASITPGTVLILLSGPYRGRRVIFLKQLPS-GLLLVTGPFKVN
NEU10037|Rpl6        S------------------------SEKAQKWYPAEDEAQPRKVRKTIR----PWSPRSTLVPGTVLILLAGRFRGKRVVLLKALDQG-VLLVTGPFKIN
GRI10036|Rpl6        H------------------------SQKASKWYPATDDNGPKAVRKSVR----PWNPRKSLEPGTVLILLAGRFRGKRVVLLKNLDQG-VLLVTGPFKIN
GRA10037|Rpl6        S------------------------TEKAKKWYPAGDDAENKKVRKAVR----SWTPRSSLQPGTVLILLAGRFRGKRVILLKSLDQG-VLLVTGPFKIN
STA10036|Rpl6        K------------------------PQKASKYYPAEDVAVPKKARKTVR----PAKPRASLQPGTVVILLAGRFRGKRVVLLKHLPQG-VLLVTGPFKVN
YAR10037|Rpl6        -------------------------TEKAPKWYVAEPTHVKIPTVQNK------SKLRPSLVPGAVLILLAGRFRGKRVVLLKSLEDG-TLLVTGPFKVN
POM10062|RPL6        A------------------------GEAAAKYYPAYRENVPKKARKAVR----PTKLRASLAPGTVCILLAGRFRGKRVVVLSQLED--TLVVTGPYKVN
YST10061|RPL6A       -------------------------AQKAPKWYPSEDVAALKKTRKAAR----PQKLRASLVPGTVLILLAGRFRGKRVVYLKHLEDN-TLLISGPFKVN
YST10062|RPL6B       -------------------------AQQAPKWYPSEDVAAPKKTRKAVR----PQKLRASLVPGTVLILLAGRFRGKRVVYLKHLEDN-TLLVTGPFKVN
CIN10036|Rpl6        -------------------------VAKAPRFYPAEDVRQPKKSRKAHK----PTGLRSTITPGTVLILLAGRFRGKRVVFLKQLESG-LLLVTGPYKVN
NEA10036|Rpl6        -------------------------TNKASKYYPAEDVRKPKVSRKTPG----KTILRSSITPGTVLILLAGRFSGKRVVFLKQLDSG-LLLVSGPHKLN
MAY10036|Rpl6        -------------------------TQKAPRFYPAEEARIPKANRKVNK----QTKLKSNIAPGSVLILLAGRFRGKRVVFLKQLESG-LLLVTGPFKVN
RHI10136|Rpl6        -------------------------AQKAPRFYPAEDVPQPKVSRKTAK----KTALRSTITPGTVVILLAGRYRGKRAVVLKQLDSG-LLLVTGPFKIN
RHI10137|Rpl6-2      -------------------------AQKAPRFYPAEDVPQPKVNRKSAK----KTALRSNITPGTVLILLAGRYRGKRAVFLKQLDSG-LLLVTGPFKVN
RHI10138|Rpl6-3      -------------------------AQKAPRFYPAEDVPQPKVSRKTAK----KTALRSTITPGTVVILLAGRYRGKRAVVLKQLDSG-LLLVTGPFKIN
RHI10139|Rpl6-4      -------------------------AQKAPRFYPAEDVPQPKVNRKSAK----KTALRSNITPGTVLILLAGRYRGKRVVFLKQLDSG-LLLVTGPFKVN
ARA10099|RPL6A       P------------------------VEKPAKFYPAEDVKKPLVNRRKPK----PTKLKASITPGTVLIILAGRFKGKRVVFLKQLSSG-LLLVTGPFKIN
ARA10100|RPL6B       P------------------------VEKPPKFYPAEDVKKPLPNRRTAK----PAKLRASITPGTVLIILAGRFKGKRVVFLKQLASG-LLLVTGPFKIN
ARA10101|RPL6C       P------------------------VEKPPKFYPAEDVKKPLPNRRTAK----PTKLRASITPGTVLIILAGRFKGKRVVFLKQLASG-LLLVTGPFKIN
RIC10112|RPL6C       A------------------------AAAAPKFYPADDVKPRQPSTRKPN----PTKLRSSITPGTVLILLAGRFMGKRVVFLKQLKSG-LLLVTGPFKIN
GMA10179|LOC10078410 P------------------------AQKPPKFYPADDVKKPLVNKHKPK----PAKLRASITPGTVLILLAGRFKGKRVVFLKQLPSG-LLLVTGPFKIN
GMA10180|LOC10080934 P------------------------AEKPPKFYPADDIKKPLVNKHKPK----PAKLRASITPGTVLILLAGRFKGKRVVFLKQLPSG-LLLVTGPFKIN
GMA10181|LOC10078535 P------------------------TEKPPKFYPADDVKKPLVNKHKPK----PAKLRASITPGTVLILLAGRFKGKRVVFLKQLPSG-LLLVTGPFKVN
GMA10182|LOC10080934 P------------------------AEKPPKFYPADDIKKPLVNKHKPK----PAKLRASITPGTVLILLAGRFKGKRVVFLKQLPSG-LLLVTGPFKVN
GMA10183|LOC10081172 P------------------------AQKPPKFYPADDVKKPLVNKHKPK----PAKLRASITPGTVLILLAGRFKGKRVVFLKQLPSG-LLLVTGPFKIN
GMA10184|LOC10050002 P------------------------AEKPPKFYPADDVKKPLVNKHKPK----PAKLRASITPGTVLILLAGRFKGKRVVFLKQLPSG-LLLVTGPFKIN
POP10036|RPL6        P------------------------AEKPPKFYPADDVKKPLPNRRKPK----PTKLRDSITPGTVLIILVGRFKGKRVVFLKQLPSG-LLLVTGPFKIN
CRE10036|RPL6        A------------------------EGKAPRFYPADDVPKPLSHNAVHK----QTKLRASITPGTVLILLAGRFKGKRVIFLGQLPSG-LLLVTGPFKLN
VOL10039|RPL6        P------------------------EGKAPRFYPADDVPKPLAHKAVNK----PTQLRASITPGTVLILLAGRFKGKRVIFLSQLPSG-LLLVTGPFKLN
HEM10033|rpl6B       S------------------------HLSQNLFQKSSSLREKRTKTLKNKR--LIIKTKKKFKIGSIIILLGSKFQGKKAVLLKITKKG-LLIISGPFSVN
PTR10038|RPL6        S------------------------SQKPPRYYPAEDAKSSKSTYKVRQN---PPKIRKSITPGTVLIILAGRFRGKRVVCLKPLESG-LLLVSGPYKIN
TPS10036|Rpl6        S------------------------KGKSARYYPADDIPRPKHSRAKKHN---APKVRASLTPGTVCILLSGRFRGKRVVCLKALESG-LLLVTGPYKIN
CYA10037|RPL6        A------------------------PKRKPSFYPVDARVRRLHTSAKKRSQKQRTRLRNSIQPGTVLIMLAGRFRGKRVVFLRQLEHSGLLLVTGPFALN
DIC10036|RPL6        K------------------------RVIAAKASKFAPSIPAEIRSTAAKKVQQKVALRKSITPGTVLIILAGRFAGKRVVALKQLDSG-LILITGPFKVN
PLA10040|RPL6        R------------------------------------------------------KLRKSIEVGKVAIILTGKHMGKRCIITKILNSG-LLAVVGPYEIN
TGO10036|RPL6        K------------------------PKRQLYKSPAGAAKR-------------MAKLRSSITPGTVLILLSGGHRGKRVVFLKQLAPSGLLLVTGPFKVN


HUM10037|RPL6        RVPLRRTHQKFVIATSTKIDISNVK---------IPKHLTDAYFKKKKLRKPRHQ-EGEIFDTE---------KEKYEITEQRKIDQKAVDSQILPKIKA
DOG10036|Rpl6        RVPLRRTHQKFVIATSTKIDISSVK---------IPKHLTDAYFKKKKLRKPRHQ-EGEIFDTE---------KEKYEITEQRKVDQKAVDSQILPKIKA
MUS10036|Rpl6        RVPLRRTHQKFVIATSTKVDISDVK---------IPKHLTDAYFKKKQLRKPRHQ-EGEIFDTE---------KEKYEITEQRKADQKAVDLQILPKIKA
RAT10036|Rpl6        RVPLRRTHQKFVIATSTKVDISKVK---------IPKHLTDAYFKKKPLRKPRHQ-EGEIFDTE---------KEKYEITEQRKADQKAVDSQILPKIKA
CHK10037|Rpl6        RVPLRRAHQKFVIATSTKVDISGVK---------IPKHLTDAYFKKKKLRKPKHQ-EGEIFDTE---------KEKYEITEQRKTDQKAVDSQILARIKK
FUG10037|RPL6        RVPLRRAHQKFVIATNTKVDIAGMK---------IPKTLNDAYFKKKKLRRPRHQ-EGEIFDTE---------KEKYQLTEQRKEDQKAVDAQLLPLIKK
DAN10036|Rpl6        RVPLRRAHQKFCIATNTKVDISGMK---------IPRTLTDSYFKKKKLRKPKHQ-EGEIFDTE---------KEKYQLTEQRKADQKAVDSQLLPLIKK
MED10036|Rpl6        RVPLRRAHQKFVIATNTKVDITGMK---------IPKTLNDAYFKKKKLRRPRHQ-EGEIFDTE---------KEKYQLTEERKEIQKEVDSKLLPLIKK
CIO10036|RPL6        GVPLRRINQVYVIATKTKVDVSGVT---------IPKRVNDAYFKRKELSKPKHG-EGEIFETD---------EQKYTVSDERKEDQTAVDKQVLAVLGK
DRO10049|RpL6        SCPLRRVSQRYVIGTSSKVDLGAFK---------VPEHLNDAYFRRLKAKKDKKTGEADIFAAK---------KERFVPNEQRKKDQKEVDAALLKVIKA
MOS10036|Rpl6        SCPMRRIAQNYVIATTTRVNLRGVK---------VPEHIDDRYFRRVHPKKDSRT-ERDIFARK---------EFKYVPTEQRKADQKTVDTAVMAAIKA
BEE10037|Rpl6-1      ACPLRRVSQNYVIATSTRINISGLK---------IPSHINDDYFKRKREKRAKKE-EGDIFSKK---------KDEYKPSDQRKADQKVVDKFVISAIKR
CEL10036|rpl-6       GFPLRRIGQAFVIATSLKVNVSGVK---------IPEHINDEYFKRK---STAQKTGKNIFASG---------KTEYTVSEQRKKDIKTVDAPILAAIKK
BMA10036|RPL6        STPLRRIAQAFVIATKTKLDISGLK---------VPEHIDDAYFRRFNFKKAPKKGDANIFTQG---------TTEYTVSDQRKADQKAVDNVVLEVIRK
STE10036|RPL6        GVPLRRIPQSYVIATSTHIDVSDVK---------LPEHAFADESYFKGEPKKKKR-SEDMFEEA---------AEEKKPSEQRIADQKAVDDQILPKISA
MBR10036|RPL6        GVPLRRVNQAYVIATSTKLDISSVK---------VDDKINDAYFKAENKAAKAKD---ITEGDK---------QEKEPLSAERKADQESIDKAILAIVKK
NEU10037|Rpl6        GVPLRRVNARYVIATSQKVDLAGIDE-------AKINEIAQPKYFTAEKSKEKAGEEAFFKQGE--------KPQKKEVSSSRVADQKAIDKALIANIKK
GRI10036|Rpl6        GVPLRRVNARYVIATSQKVDLSGVDT-------GKIDEVAAPKYFTAEKAKEKAGEEAFFKQGE--------KPEKKQVNSTRAADQKAIDKALIANIKK
GRA10037|Rpl6        GVPLRRVNSRYVIATSYKVDISGLDE-------SKIEEISQPKYFTAEKAKEKAGEEAFFKQGE--------KPQKKEVNSSRAADQKAIDKALIANIKK
STA10036|Rpl6        GVPLRRVNARYVIATSTTVDLKGIDS-------KVLDKVSEDGYFTKDKAAHKPGEDSFFKQGE--------KPEKKETSKDRVEDQKSVDKALLATLKK
YAR10037|Rpl6        GVPLRRVNARYVIATST-KVDVSG---------VKADKFTPAYFARSSADKKAEK--QFFAEG----------KQK-ELKAERVADQKDVDAALIAEIKK
POM10062|RPL6        GVPIRRVNHRYVIATSAPKIDVSG---------VSVEKFTKAYFAKQKRSGPVKKDEAFFAEN----------APKNALPAERIADQKAVDAKLLPAIKA
YST10061|RPL6A       GVPLRRVNARYVIATST-KVSVEG---------VNVEKFNVEYFAKEKLTKKEKKEANLFPEQ----------QNK-EIKAERVEDQKVVDKALIAEIKK
YST10062|RPL6B       GVPLRRVNARYVIATST-KVSVEG---------VNVEKFNVEYFAKEKLTKKEKKEANLFPEQ----------QTK-EIKTERVEDQKVVDKALLAEIKK
CIN10036|Rpl6        GVPLRRVNQAYVIATSTKIDISGV---------KIDDKINDAYFAKAATKESRSAEEEFFADGQ--------PKPKEPYPTSKAADQKEVDKAIIAAIKG
NEA10036|Rpl6        GVPLRRVSQAYVIATSTKVDISGV---------SIPESINDAYFAKAKAAKS-SKEGEFFGEG----------KEKKAFPEEKKAEQKAVDAALIASIKK
MAY10036|Rpl6        GVPIRRVNQAYVIATSTKIDISDV---------KVDEKINDSYFKKDKAAKVKPEAAFFADPA-----------NKQAHPESKVADQKALDKAIIAAVKK
RHI10136|Rpl6        GVPLRRVNQAYVIATSTKLDLASV---------KVDEKFNDAYFKKS----AKTEKAFLEGEQ-----------KKAAFPESKAADQKAIDKALLEVVVK
RHI10137|Rpl6-2      GVPLRRVNQAYVIATSTKIDLSSA---------KVDEKFNDAYFKKS----AKTEKAFLEGEQ-----------KKAAFPESKAADQKALDKEILAAAAK
RHI10138|Rpl6-3      GVPLRRVNQAYVIATSTKLDLSNV---------KVDEKFNDAYFKKS----AKTEKAFLEGEQ-----------KKAAFPESKAADQKAIDKALLEVVVK
RHI10139|Rpl6-4      GVPLRRVNQAYVIATSSKLDLSSV---------KIDEKFNDAYFKKS----AKTEKAFLEGEQ-----------KKAAFPESKAADQKALDKEILAVAAK
ARA10099|RPL6A       GVPLRRVNQAYVIGTSTKIDISGVN----------TEKFDDKYFGKVAEKKKKKTEGEFFEAE---------KEEKKEIPQEKKEDQKTVDAALIKSIEA
ARA10100|RPL6B       GVPLRRVNQAYVIGTSTKVDISGVT----------LDKFDDKYFGKVAEKKKKKTEGEFFEAE---------KEEKKEIPQGKKDDQKAVDAALIKAIEA
ARA10101|RPL6C       GVPLRRVNQAYVIGTSTKVDISGVT----------LDKFDDKYFGKVAEKKKKKTEGEFFEAE---------KEEKKEIPQVKKDDQKAVDAALIKAIEA
RIC10112|RPL6C       GVPIRRVNQPYVIATSTKVDISGVN----------VEKFDDKYFSRDKKQKAKKTEGELFETE---------KEATKNLPEFKKEDQKVVDAELIKAIEA
GMA10179|LOC10078410 GVPLRRVNQSYVIGTSTKVDISGVN----------VDKFDDKYFAKEAKKKKTKGEGEFFEAE---------KEEKNVLPQEKKDDQKTVDTTLLKAIEN
GMA10180|LOC10080934 GVPLRRVNQSYVIGTSTKVDVSAVN----------VDQFDDKYFAKEAQKKKKKGEGEFFEAE---------KEEKSVLPQQKKDDQKTVDSALIKAIGS
GMA10181|LOC10078535 GVPLRRVNQAYVIGTSTKVDVSAVN----------VNNFDDKYFAKEAQRKKKKGEGEFFEAE---------KEEKSVLPQQKKDDQKTVDAALLKAIES
GMA10182|LOC10080934 GVPLRRVNQAYVIGTSTKVDISAVN----------VDSFGDKYFAKEAQKKKKKGEGEFFEAE---------KEEKSVLPQQKKDDQKTVDAAVLKAIES
GMA10183|LOC10081172 GVPLRRVNQSYVIGTSTKVDISDVN----------VDKFDDKYFAKEAKKKKTKGEGEFFEAE---------KEEKNVLPQEKKDDQKTVDTALLKAIES
GMA10184|LOC10050002 GVPLRRVNQSYVIGTSTKANVSAVN----------VEQFDDKYFTKEAQKKKK-GEGEFFEAE---------KEEKSVLPQQKKDDQKTVDSALIKAIES
POP10036|RPL6        GVPLRRVNQSYVIGTSTKVDISGVN----------VEKFDDKYFGKKAEKKKKKGEGNFFEAD---------KEGENALPQEKKDDQKAVDAPLIKSLEC
CRE10036|RPL6        GVPVRRVNAAYVIGTSTKVSLPKLD----------LSKFTDSYFKAVESKSSKKGEKEFFDQS---------EAKKNVLSQEYIANQKTLDAALLPALS-
VOL10039|RPL6        GVPARRVNAAYVIATSTKVELPKLD----------LSQFDDKYFQAQEEKRSKKGETEFFTAA---------DAKKKELSQQYIANQKTLDAAILPALP-
HEM10033|rpl6B       GISLRRINPRYAVPTEIGIGLNNLQ----------LGFLNDDYFNLLKNSNRLSSNYQKLKLIS-----------------FHRVRQSVIDEKLKKKILK
PTR10038|RPL6        GVPLRRVNPAYVIATSTKVDISKVDA-------ASITDE----YFSRSKDDTKEGEEAFFEG-A--------APKPAVVSDARKEDQKKVDAALLQAVAA
TPS10036|Rpl6        GVPLRRVNQAYVIATSTKVDVSGADV-------SKIDDA----YFARVKSDSAEGEEEFFAN-D--------AAKPAVVSDQRKADQKKVDAAILKAVES
CYA10037|RPL6        GVPLRRVNQVYVIATKTRVDISGIDT-------SSVDDTWFTKGARKAREERKKARLR--GADGSGG----ESTVKQCLPEEKKNLQKQIDGQVMKAVEG
DIC10036|RPL6        GVPLRRIDQRYVIATSTKIDVSSVK---------VAATINDAYFAAEKKSTTKSEGAFFSDEKK---------AEKKKIADSRVADQKSVDSAILAVLKK
PLA10040|RPL6        GVPLKRVDSRYLVVTSTNIFNFENIAKLKDDFLNYAQDIDDDSFIKTLEIKKKQKKLLKNKNEALFMNNVIDKIKEIRKEDPKVQKLEGIQKDIGSLLKP
TGO10036|RPL6        GVPLRRVNQRYVIATTTKVDISGVDV-------SSIKDEQFGASKKEKFAERKLRKKQDEGMFVQQS----DSKAKQALPAQFKQLQDSVDKALLASLSK


HUM10037|RPL6        IP----QLQGYLRSVFALTNGIYPHKLVF
DOG10036|Rpl6        VP----QLQGYLRSVFSLTNGVYPHKLVF
MUS10036|Rpl6        VP----QLQGYLRSQFSLTNGMYPHKLVF
RAT10036|Rpl6        VP----QLQGYLRSQFSLTNGMYPHKLVF
CHK10037|Rpl6        VP----QLRGYLRSTFSLSNGVYPHKLVF
FUG10037|RPL6        VP----QMKGYLRSTFCLSNGVYPHKLVF
DAN10036|Rpl6        VP----QLRGYLRSMFSLSNGVYPHKLVF
MED10036|Rpl6        VP----QLKGYLRSSFYLTNGVYPHKLVF
CIO10036|RPL6        DE----YMKGYLTGKFSLQTGQYPHNMVF
DRO10049|RpL6        HPEG-KFFAKYLQNMFALHSSQYPHRMRF
MOS10036|Rpl6        HPEG-KLIQRYLKSMFSLRTNMFPHRMKF
BEE10037|Rpl6-1      NKEK-KMLFTYLSAMFGLRSSQYPHRLKF
CEL10036|rpl-6       HPEH-KFLFGYLGTRFSLGKNQYPHKMQF
BMA10036|RPL6        HPEK-KYLFGYLGSRFALGKNQFPHRMLF
STE10036|RPL6        VP----NMKKYLSSLFSLRKGQFPHDMVF
MBR10036|RPL6        TD----YMKGYLQTRFTLTNGVYPHAISF
NEU10037|Rpl6        V----EFLASYLASSFTLRKGDKPHEMKW
GRI10036|Rpl6        V----EFLASYLATSFSLRKGDKPHEMKW
GRA10037|Rpl6        V----DMLASYLSSSFSLRKGDKPHEMAW
STA10036|Rpl6        E----AHLIDYLSASFSLRSSDRPHQMVF
YAR10037|Rpl6        T----PLLKQYLASQFSLKSGDKPHLLKF
POM10062|RPL6        I----PNMKEYLAASFALSNGDRPHLMKF
YST10061|RPL6A       T----PLLKQYLSASFSLKNGDKPHMLKF
YST10062|RPL6B       T----PLLKQYLSASFSLKNGDKPHLLKF
CIN10036|Rpl6        T----EYLGKYLKASWGLSKGQFPHALVF
NEA10036|Rpl6        V----ENLSKYLKSSWGLSKSDRFHELKF
MAY10036|Rpl6        AG---PTMAKYLAATFSLSKGEKPHALKF
RHI10136|Rpl6        T----PFLRQYLSSTFGLRKGQFPHDLKF
RHI10137|Rpl6-2      D----AYLVSYLKSTFSLRKGQFPHDMKF
RHI10138|Rpl6-3      T----PFLRQYLSSTFGLRKGQFPHDLKF
RHI10139|Rpl6-4      N----AYFVSYLKSTFSLRKGQFPHDMKF
ARA10099|RPL6A       V----PELKVYLGARFSLSQGMKPHELVF
ARA10100|RPL6B       V----PELKTYLGARFSLKQGMKPHELVF
ARA10101|RPL6C       V----PELKTYLGARFSLKQGMKPHELVF
RIC10112|RPL6C       V----PDLKTYLGARFSLRDGDKPHEMVF
GMA10179|LOC10078410 V----PDLKSYLGARFSLKAGVKPHELVF
GMA10180|LOC10080934 V----PDLKTYLGARFSLKAGVKPHELVF
GMA10181|LOC10078535 V----PDLKSYLGARFSLKAGVKPHELVF
GMA10182|LOC10080934 V----PDLKSYLGARFSLKAGVKPHELVF
GMA10183|LOC10081172 V----PELKSYLGARFSLKAGVKPHELVF
GMA10184|LOC10050002 V----PDLKTYLGARFSLKAGVKPHELVF
POP10036|RPL6        V----PDLKAYLGARFSLKDGMKPHELVF
CRE10036|RPL6        -----ADLKGYLSTRFTLKDGDRPHLMKF
VOL10039|RPL6        -----AELKGYLSARFTLKDGDRPHLMKF
HEM10033|rpl6B       N--------------FFLKFYMKSKTKRF
PTR10038|RPL6        V----PMLEGYLAAHFTLSSSDKPHKMKF
TPS10036|Rpl6        T----PLMKNYLGSNFSLKKHDRPHEMIF
CYA10037|RPL6        I----PLLREYLSSRFTLTKGQYPHRMTF
DIC10036|RPL6        EK----FLTVYLKTKFYLKKGEFPHQLKF
PLA10040|RPL6        EILKNKVFAHYLKSKFTLRNDMVLHKMKF
TGO10036|RPL6        D----KLLTQYLKTRFTLRGNMRPHEMKF