CLUSTAL W (2.1) Multiple Sequence Alignments
HAL10020|VNG1709G    --------MARVEIEIPDDVTAEVD-HLDLTVEGPEGSVTRRLWYP-DVDVSVEDDAVVVASEVDDAKTDSTVGTFESHVANMFHGVSEGWEYKLEVHYS
MET10031|MJ0471      ---MPVAAYIEERVKIPENVQVEIN-NNEVVVKSGGKELRRRFEHP-KIVIKKEGDEIVIFCEYPRRKDKAMVGTIRAHINNMIKGVTEGFTYKLKIRYA
PYR10020|PH1763      VREMPVDAWIREEIEIPEGVEVSVQ-DYNVKVKGPKGEVEKKLFWP-GVKIFVEDGKVVIYKDFPRRKDVAIVRTFKAHINNMIKGVTEGFTYKLKVVYS
THE10026|TTHA1677    -----MSRIGRLPIPVPKGVSVEVA-PGRVKVKGPKGELEVPVSPE--MRVVVEEGVVRVERPSDERRHKSLHGLTRTLIANAVKGVSEGYSKELLIKGI
SYN10028|sll1810     -----MSRIGKRPIPLPAKVSVDIQ-GSHLSVKGPKGSLERQLPEK--VIVAQEGETITVTRQDESRTARERHGLVRTLVANMVDGVAQGFERRLEIQGV
BAC10027|Bsu0131     -----MSRVGKKLLEIPSDVTVTLNDNNTVAVKGPKGELTRTFHPD--MEIKVEDNVLTVARPSDQKEHRALHGTTRSLLGNMVEGVSKGFERGLELVGV
ECO10027|rplF        -----MSRVAKAPVVVPAGVDVKIN-GQVITIKGKNGELTRTLNDA--VEVKHADNTLTFGPRDGYADGWAQAGTARALLNSMVIGVTEGFTKKLQLVGV
SUL10021|ST0418      ----MKAVHLYEEIEIPQGINVNIE-GMKIKVKGPKGEIEKDFSHISGIEIRKEDNKIVVETTFADRRKKAQFYSIIAHIENMFTGVTKGYRYYLKIIYT


HAL10020|VNG1709G    HFPMQVDVEGEEVVIQNFLGEKAARRTQIRGDTDVVVDDE-EVTLSGPSIEDVGQTAADIEQLTRVTDKDTR-VFQDGVYIVEKPAKGGA---
MET10031|MJ0471      HFPMKVSVKGNEVIIENFLGEKHPRRARIMEGVTVKISGE-DVIVTGIDKEKVGQTAANIEQATRIKGRDPR-VFQDGIYIVEKAGKAI----
PYR10020|PH1763      HFPITVKVQGDEVIIENFLGEKAPRRAKILPGVTVKVKGQ-EIIVEGIDKEATGQTAANIEQATRITKWDRR-VFQDGIYIVEKAGKPITF--
THE10026|TTHA1677    GYRARLVGR----ALELTVGFSHPVVVEPPEGITFEVPEPTRVRVSGIDKQKVGQVAANIRAIRKPSAYHEKGIYYAGEPVRLKPGKAGAKK-
SYN10028|sll1810     GYRAQAQGN----KLTLNVGYSKPVEMTMPQGIEVKVENNTQVIVSGIDKELLGNTAAKIRAVRPPEPYKGKGIRYQGEYVRRKAGKTGKK--
BAC10027|Bsu0131     GYRASKSGN----KLVLNVGYSHPVEIVPEEGIEIEVPSQTKVVVKGTDKERVGAIAANIRAVRSPEPYKGKGIRYEGEVVRRKEGKSAK---
ECO10027|rplF        GYRAAVKGN----VINLSLGFSHPVDHQLPAGITAECPTQTEIVLKGADKQVIGQVAADLRAYRRPEPYKGKGVRYADEVVRTKEAKKK----
SUL10021|ST0418      HFPVTVKVSGNEVQIQNLIGEKNIRRAKIMTGVKVNVKGE-DIIVEGQDIEKVGQTAANIELASKITGYDRR-VFADGIYIYKKEVIGSEQTD