CLUSTAL W (2.1) Multiple Sequence Alignments
HAL10023|VNG1103G    --------MEYVYAALILNEADEELTEDNITGVLEAAGVD------VEESRAKALVAALEDVDIEEAVEEAAAAPAAAPAASGSDDEAAADDGDDDEEAD
MET10036|MJ0508      --------MEYIYAALLLHSAGKEITEDAIKAVLSAAGVE------VDDARVKALVAGLEGVDIEEAIANA-AMP--VAAAP-----AAAAPAAAAEEKK
PYR10022|PH1998      -----VMEMEYVYAALLLHSVGKEINEENLKAVLQAAGVE------PEEARIKALVAALEGVNIDEVIEKA-AMPVAVAAAP-----AAAPAEAGGEEKK
THE10030|TTHA0210    MALDIERIKEELSQATVLELKQLIDALKEAWGVTAAAPVAVAA-APAAGAAAAPAEEKTEFDVILKEAGAK-KLEVIKELRAITGLGLKEAKDLAE-KGG
SYN10032|sll1746     MSAATDQILEQLKSLSLLEASELVKQIEEAFGVSAAAPVGGMVMAAAAAAPAEAAEEKTEFDVILEEVPADKKIAVLKVVRTITGLGLKEAKELVESTPK
BAC10031|Bsu0105     MALNIEEIIASVKEATVLELNDLVKAIEEEFGVTAAAPVAVAG-GAAAGGAAE---EQSEFDLILAGAGSQ-KIKVIKVVREITGLGLKEAKELVDNTPK
ECO10031|rplL        MSITKDQIIEAVAAMSVMDVVELISAMEEKFGVSAAAAV------AVAAGPVEAAEEKTEFDVILKAAGAN-KVAVIKAVRGATGLGLKEAKDLVESAPA
SUL10024|ST1365      -----VIDMEYIYASLLLHSAKKEINEENLKNVLTAAGIT------VDEVRLKAVVAALKEVNIDEVLKNATAMPVAVAAAP-----AAAPAQQAEKKEE


HAL10023|VNG1103G    ADEAAEAEDAGDDDDEEPSGEGLGDLFG
MET10036|MJ0508      EEEKKEEKKEED----TAAVAGLAALFG
PYR10022|PH1998      EEEKKEEEEKEEEVSEEEALAGLSALFG
THE10030|TTHA0210    PVKEGVSKQEAEEIKKKLEAVGAVVELK
SYN10032|sll1746     AIKEATGKDDAEAIKKQIEEAGGKAAVK
BAC10031|Bsu0105     PLKEGIAKEEAEELKAKLEEVGASVEVK
ECO10031|rplL        ALKEGVSKDDAEALKKALEEAGAEVEVK
SUL10024|ST1365      KKEEEEKKGPSE----EEIGGGLASLFG