CLUSTAL W (2.1) Multiple Sequence Alignments
HUM10040|RPL8        MGRVIRGQRKGAG-SVFRAHVKHRKGAARLRAVDFAERHGYIKGIVKDIIHDPGRGAPLAKVVFRDPYRFKKRTELFIAAEGIHTGQFVYCGKKAQLNIG
DOG10039|Rpl8        MGRVIRGQRKGAG-SVFRAHVKHRKGAARLRAVDFAERHGYIKGIVKDIIHDPGRGAPLAKVVFRDPYRFKKRTELFIAAEGIHTGQFVYCGKKAQLNIG
MUS10039|Rpl8        MGRVIRGQRKGAG-SVFRAHVKHRKGAARLRAVDFAERHGYIKGIVKDIIHDPGRGAPLAKVVFRDPYRFKKRTELFIAAEGIHTGQFVYCGKKAQLNIG
RAT10039|Rpl8        MGRVIRGQRKGAG-SVFRAHVKHRKGAARLRAVDFAERHGYIKGIVKDIIHDPGRGAPLAKVVFRDPYRFKKRTELFIAAEGIHTGQFVYCGKKAQLNIG
CHK10040|Rpl8        MGRVIRGQRKGAG-SVFRAHVKHRKGPAKLRAVDFAERHGYIKGIVKDIIHDPGRGAPLAKIAFRDPYRFKKRTELFIAAEGIHTGQFVYCGKKAQLNIG
FUG10040|RPL8        MGRVIRGQRKGAG-SVFKAHVKHRKGAAKLRHIDFAERHGYIKGIVKDIIHDPGRGAPLAKVAFRDPYRFKKRTELFIAAEGIHTGQFIYCGKKAQLNIG
DAN10039|Rpl8        MGRVIRGQRKGAG-SVFKAHVKHRKGAAKLRHIDFAERHGYIKGIVKDIIHDPGRGAPLAKVMFRDPYRFKKRTELFIAAEGIHTGQFIYCGKKAQLNIG
MED10039|Rpl8        MGRVIRGQRKGAG-SVFKAHVKHRKGAAKLRHIDFAERNGYIKGIVKDIIHDPGRGAPLAKVVFRDPYRFKKRTELFIAAEGIHTGQFIYCGKKAQLNIG
CIO10039|RPL8        MGRVIRSQRKGPG-SIFKAHTTHRKGAAKLRSVDFAERHGYIKGIIKDIVHDPGRGAPLVKVQFQDPYKYRRRLETFVAVEGNFTGQSIYCGKKAQLTIG
DRO10053|RpL8        MGRVIRAQRKGAG-SVFKAHVKKRKGAAKLRSLDFAERSGYIRGVVKDIIHDPGRGAPLAVVHFRDPYRYKIRKELFIAPEGMHTGQFVYCGRKATLQIG
MOS10039|Rpl8        MGRVIRAQRKGAG-SVFRAHTKKRKGEPKLRHLDYAERHGYLKGVVKQIIHDPGRGAPLAVVNFRDPYRFRLSKQLFIAAEGMYTGQFVYCGRRAQLQIG
BEE10041|Rpl8        MGRVIRAQRKGAG-SVFRSHTKRRKGAPKLRSLDFSERHGYIKGVVKDIIHDPGRGAPLAVVHFRDPYKFKTRKELFIAPEGMYTGQFLYCGKKANLQIG
CEL10039|rpl-2       MGRRIRIQRKGAG-GIFKSHNKHRKGASKLRPLDYAERHGYIKGLVKDIIHDPGRGAPLAIIAFRDPYKYKTVKTTVVAAEGMHTGQFIHCGAKAQIQIG
BMA10039|RPL8        MGRRIRVQRKGPG-GIFKAHNKHRKGAAKLRPVDYAERHGYIKGVVKTIMHDPGRGAPLALVEFRDPYRYKILKSTMIAAEGMHTGQFIYCGRKAQVQVG
STE10039|RPL8        MGRVIRGQRKGAG-SIFTSHTKHRKGAANLRVHDYAERHGYIKGVVKEIIHDPGRGAPLAVVVFRDPYRYKLRKELFVATEGMYTGQFIYCGKKAALQIG
MBR10039|RPL8        MGRVIRGQRKGAG-SIFTSHTKHRKGAARLRPVDYAERHGFIKGMVREIIHDPGRGAPLARVVFRDPYRYRLQKETFVCAEGMHTGQFIYCGKKAELSVG
NEU10040|Rpl8        MGRVIRNQRKGRG-SIFTANTRLNKAPAKFRSLDYAERHGYIRGVVKEIIHDPGRGAPLARVVFNSPYKFKKQRETFIANEGMYTGQFIYAGKNAALTVG
GRI10039|Rpl8        MGRVIRNQRKGAG-GIFKAVTRLNKNPAKFRNLDYAERHGYVRGIVKEIIHDPGRGAPLARVVFRDPYKFKKHTETFIANEGMYTGQFVYAGKNAALTVG
GRA10040|RPL8        MGRVIRNQRKGRG-SIFTANTRLNKAPAKFRNLDYAERHGYLRGVVREIVHDAGRGAPLAKVVFRHPYRFKQVTETFIANEGMYTGQFIYAGKKAALTVG
YAR10040|Rpl8        MGRVIRNQRKGAG-SIFTAHTRLRKGAAKLRDLDYAERHGYIRGVVKEIIHDPGRGAPLAKVVFRDPYKYKQRVETFIANEGVYTGQFIYAGKKATLNVG
POM10067|RPL8-1      MGRVIRAQRK-SG-GIFQAHTRLRKGAAQLRTLDFAERHGYIRGVVQKIIHDPGRGAPLAKVAFRNPYHYRTDVETFVATEGMYTGQFVYCGKNAALTVG
POM10068|RPL8-2      MGRVIRAQRK-SG-GIFQAHTRLRKGAAQLRTLDFAERHGYIRGVVQKIIHDPGRGAPLAKVAFRNPYHYRTDVETFVATEGMYTGQFVYCGKNAALTVG
POM10069|RPL8-3      MGRVIRAQRK-SG-GIFQAHTRLRKGAAQLRTLDFAERHGYIRGVVQKIIHDPGRGAPLAKVAFRNPYHYRTDVETFVATEGMYTGQFVYCGKNAALTVG
YST10068|RPL2A       MGRVIRNQRKGAG-SIFTSHTRLRQGAAKLRTLDYAERHGYIRGIVKQIVHDSGRGAPLAKVVFRDPYKYRLREEIFIANEGVHTGQFIYAGKKASLNVG
YST10069|RPL2B       MGRVIRNQRKGAG-SIFTSHTRLRQGAAKLRTLDYAERHGYIRGIVKQIVHDSGRGAPLAKVVFRDPYKYRLREEIFIANEGVHTGQFIYAGKKASLNVG
CIN10040|Rpl8        MGRVIRAQRR-SH-AIFKSHTHHNKNPARLRNLDFAERNGYIRGVVKEIIHDAGRGAPLAVVVFRDPYRYKLRKETFIATEGLHTGAFVYCGKKATLNVG
NEA10039|Rpl8        MGRVIRAQRK-SG-GIFKSHTHHNKNPARLRNLDFAEKNGYIRGVVKDIIHDAGRGAPLATVVFRDPYRYKLRKETFLAAEGLSTGSFVYCGKKATLNVG
MAY10039|Rpl8        MGRVIRAQRK-SG-GIFTAHTKHNKAPAKLRVYDYAERNGYIRGVVKEIIHDAGRGAPLAKVAFRDPYKYRTRVETFVATEGLSTGQFVYCGKKAALNVA
RHI10148|Rpl8        MGRVIRAQRKGAG-SIFKSHTVGRKGAAKLRVFDFAERHGYVRGIVKEIVHDPGRGAPLAKVVFRDPYKYKLRTETFIATEGMYTGQFIYAGKKASLNIG
RHI10149|Rpl8-2      MGRVIRAQRKGAG-SIFKSHTVGRKGAAKLRVFDFAERHGYVRGIVKEIVHDPGRGAPLAKVVFRDPYKYKLRTETFIATEGMYTGQFIYAGKKASLNIG
RHI10150|Rpl8-3      MGRVIRAQRKGAG-SIFKSHTVGRKGAAKLRVFDFAERHGYVRGIVKEIVHDPGRGAPLAKVVFRDPYKYKLRTETFIATEGMYTGQFIYAGKKASLNIG
RHI10151|Rpl8-4      MGRVIRAQRKGAG-SIFKSHTVGRKGAAKLRVFDFAERHGYVRGIVKEIVHDPGRGAPLAKVVFRDPYKYKLRTETFIATEGMYTGQFIYAGKKASLNIG
ARA10108|RPL8A       MGRVIRAQRKGAG-SVFKSHTHHRKGPAKFRSLDFGERNGYLKGVVTEIIHDPGRGAPLARVTFRHPFRFKKQKELFVAAEGMYTGQFLYCGKKATLVVG
ARA10109|RPL8B       MGRVIRAQRKGAAGSVFKSHTHHRKGPAKFRSLDYGERNGYLKGLVTEIIHDPGRGAPLARVAFRHPFRYMKQKELFVAAEGMYTGQYLYCGKKANLMVG
ARA10110|RPL8C       MGRVIRAQRKGAG-SVFKSHTHHRKGPAKFRSLDFGERNGYLKGVVTEIIHDPGRGAPLARVAFRHPFRFKKQKELFVAAEGMYTGQFLYCGKKATLVVG
RIC10123|RPL8A       MGRVIRAQRKGAG-SVFKSHTHHRKGPARFRSLDFGERNGYLKGVVTDIIHDPGRGAPLAKVTFRHPFRYKHQKELFVAAEGMYTGQFVYCGRRATLSIG
GMA10195|LOC10079831 MGRVIRAQRKGAG-SVFKSHTHHRKGPARFRSLDFGERNGYLKGVVTDIIHDPGRGAPLAKVAFRHPFRYKKQMELFVAAEGLYTGQFIYCGKKATLVVG
GMA10196|LOC10080213 MGRVIRAQRKGAG-SVFKSHTHHRKGPARFRSLDFGERNGYLKGVVTDVIHDPGRGAPLAKVAFRHPFRYKKQNELFIAAEGLYTGQFIYCGKKATLVVG
GMA10197|LOC10052783 MGRVIRAQRKGAG-SVFKSHTHHRKGPARFRSLDFGERNGYLKGVVTDIIHDPGRGAPLAKVAFRHPFRYKKQTELFVAAEGLYTGQFVYCGKKATLVVG
GMA10198|rpL2        MGRVIRAQRKGAG-SVFKSHTHHRKGPARFRSLDFGERNGYLKGVVTDVIHDPGRGAPLAKVAFRHPFRYKKQNELFIAAEGLYTGQFIYCGKKATLVVG
POP10039|RPL8        MGRVIRAQRKGAG-SVFKSHTHHRKGPARFRSLDFGERNGYLKGVVTEIIHDPGRGAPLARVTFRHPFRYKKQKELFVAAEGMYTGQFVYCGKKANLMVG
CRE10039|RPL8        MGRVIRSQRKGRG-GIFKSHNTHRKGAAQHRVMDSAERNHYIKGVVAEVIHDPGRGAPLARVTFRDPIRYKHQKELFIAAEGIYSGQFIYCGRKAALSIG
VOL10042|RPL8        MGRVIRSQRKGRG-GIFKSHNTHRKGAAKHRVLDAAERNHYIKGVVSEVLHDPGRGAPLARVTFRDPIRYKHQKSLFVAAEGVYTGQFIYCGRKATLSIG
HEM10036|rpl8        MGRVIRSQRKGAG-SIFRSHTTKRKGKALFRPYDYSEKCGYTKGIVKKIIHDPGRGAPLAMVQFKNMYRYKKLFSTFIATEGMYTGQNIYCGKQARLMVG
PTR10041|RPL8        MGKYVQAQRKGKS-PIFQAHTRTRKGAVKLRALDYAEKHGYIRGVVKEILHDPGRGAPVAKVQFRDAYRYQRNNELLVCTEGMYTGQFIYCGKKASLTVG
TPS10039|Rpl8        MGKYVQAQRKGKS-PVFKAHTRTRKGAVKLRSIDYAERRGYVRGVVKEILHDPGRGAPVAKIQFLNAYRFKRDTELMVATEGMYTGQFIYCGKKATLNCG
CYA10040|RPL8        MGRVIRGQRRGAG-GIFKAHTSKRKGPVKLRPVDFAERNGYIRGLVTAIEHDPGRGAPVAIVEFQDPYRYKKRKERILAVEGMYTGMSVYFGKKAVLAVG
DIC10039|RPL8        MGRIIRAQRKGKAGSVFGAHTHHRKGTPRFRALDYAERQGYVKGVVKEIIHDPGRGAPLARVVFKGLTQFKLDKQLFIAPEGMHTGQFVFAGKKATLTIG
PLA10045|RPL8        MGRVIRGQRKGRG-SIFKSHNHHRKGAAKLRHLDYCEKKGYIKGLVKDIIHDPGRGAPLAKVIFKRTEKYGKKEELIIASEGMFTGQYISCGTKAPLSVG
TGO10039|RPL8        MGRVIRAQRKGRG-SVFRAHTHKRKGEAKLRPLDFAERRGYIKGLVKDILHDPGRGAPLAEVSFRDAYRYKLNKQRMVAVEGMYTGQFIYCGKNAALTIG
GIA10039|Rpl8        MGRRIRVQRKGAG-SVFRAHVARRLGAAKLRANDFAERTGSVRGVVKAILHDRGRGAPLARVQFPNMRGEGRVNELFIAPEGMYTGQEVFSGNKATLHIG


HUM10040|RPL8        NVLPVGTMPEGTIVCCLEEKPGDRGKLARASGNYATVISHNPETKKTRVKLPSGSKKVISSANRAVVGVVAGGGRIDKPILKAGRAYHKYKAKRNCWPRV
DOG10039|Rpl8        NVLPVGTMPEGTIVCCLEEKPGDRGKLARASGNYATVISHNPETKKTRVKLPSGSKKVISSANRAVVGVVAGGGRIDKPILKAGRAYHKYKAKRNCWPRV
MUS10039|Rpl8        NVLPVGTMPEGTIVCCLEEKPGDRGKLARASGNYATVISHNPETKKTRVKLPSGSKKVISSANRAVVGVVAGGGRIDKPILKAGRAYHKYKAKRNCWPRV
RAT10039|Rpl8        NVLPVGTMPEGTIVCCLEEKPGDRGKLARASGNYATVISHNPETKKTRVKLPSGSKKVISSANRAVVGVVAGGGRIDKPILKAGRAYHKYKAKRNCWPRV
CHK10040|Rpl8        NVLPVGTMPEGTIVCCLEEKPGDRGKLARASGNYATVISHNPETKKTRVKLPSGSKKVISSANRAVVGIVAGGGRIDKPILKAGRAYHKYKAKRNCWPRV
FUG10040|RPL8        NVLPVGGMPEGTIICCLEEKPGDRGKLARASGNYATVISHNPETKKSRVKLPSGSKKVISSANRAVVGVVAGGGRIDKPILKAGRAYHKYKAKRNCWPRV
DAN10039|Rpl8        NVLPVGTMPEGTIVCCLEEKPGDRGKLARASGNYATVISHNPETKKSRVKLPSGSKKVISSANRAVVGVVAGGGRIDKPILKAGRAYHKYKAKRNCWPRV
MED10039|Rpl8        NVLPVGTMPEGTIICCLEEKPGDRGKLARASGNYATVISHNPETKKSRVKLPSGAKKVIASANRAVVGVVAGGGRIDKPILKAGRAYHKYKAKRNCWPRV
CIO10039|RPL8        NVLPVGILPEGTVVCGLEEKTGDRGKLAKTSGNYATIIAHNPDTNRTRVKLPSGAKKLIPSTNRAIIGVVAGGGRIDKPLLKAGAAYHKYKAKRNCWPRV
DRO10053|RpL8        NVMPLSQMPEGTIICNLEEKTGDRGRLARTSGNYATVIAHNQDTKKTRVKLPSGAKKVVPSANRAMVGIVAGGGRIDKPILKAGRAYHKYKVKRNSWPKV
MOS10039|Rpl8        NVLPIGLMPEGTIVCNLEEKTGDRGKLARTSGNYASVIAHNPDTKRTRVKLPSGAKKVLPSANRAMIGIVAGGGRIDKPILKAGRAYHKYKVKRNCWPKV
BEE10041|Rpl8        NVMPVGQMPEGTIVCNLEEKTGDRGRLARASGNYATVIAHNPDTKKTRVKLPSGAKKVIPSNNRAMVGIVAGGGRIDKPILKAGRAYHKYKAKRNCWPKV
CEL10039|rpl-2       NIVPVGTLPEGTTICNVENKSGDRGVIARASGNYATVIAHNPDTKKTRIRLPSGAKKVVQSVNRAMIGLVAGGGRTDKPLLKAGRSYHKYKAKRNSWPRV
BMA10039|RPL8        NILPLSELPEGTTVCNLEEKTGDRGRLARTSGNYATVVAHNPETKKTRVRLPSGAKKVLDSSNRAMIGIVAGGGRTDKPLLKAGNAYHKYKAKRNCWPTV
STE10039|RPL8        NCLPVGIMPEGTIISSVEEKTGDRGRLARTSGNYATVISHNVEKKRTRVKLPSGIKKVIPSSNRALVGIVAGGGRIDKPMLKAGRAYHKYKAKRNCWPRV
MBR10039|RPL8        NVKPVGEMPEGTIVCNLEEKPGDRGVIARASGNYVTVIAHNSDTGKSRVRLPSGSKKTIPSTCRAMVGLIAGGGRIDKPLLKAGRAYYKYKAKRNCWPRV
NEU10040|Rpl8        NVLPLGSVPEGTVVSNVEEKVGDRGAIGRTSGNYVTVVGHNPEEGKTRIKLPSGAKKVVSSSARGMIGIVAGGGRTDKPLLKASRAKHKFAVKRNSWPKT
GRI10039|Rpl8        NVLPLASIPEGTIISNVEEHPGDRGALGRTSGNYVTVIGHNPDDGKTRIKLPSGAKKVVSSKARGMIGLVAGGGRTDKPLLKASRAKHKFAVKRNSWPKT
GRA10040|RPL8        NVLPLGEMPEGTVVSNVEEKIGDRGTLGRTSGNYITIVGHNPDEGKTRIKLPSGAKKVVHSGSRGMIGIVAGGGRTDKPLLKASRAKHKFAVKRNSWPKT
YAR10040|Rpl8        NVLPLGSVPEGTILSNVEEHAGDRGAIGRTSGNYVIVIGHNPDEGKTRIKLPSGSKKIVPSTARGVIGVVAGGGRIDKPLLKAGRAFHKYKVKRNSWPKT
POM10067|RPL8-1      NVLPVGEMPEGTIISNVEEKAGDRGALGRSSGNYVIIVGHDVDTGKTRVKLPSGAKKVVPSSARGVVGIVAGGGRIDKPLLKAGRAFHKYRVKRNCWPRT
POM10068|RPL8-2      NVLPVGEMPEGTIISNVEEKAGDRGALGRSSGNYVIIVGHDVDTGKTRVKLPSGAKKVVPSSARGVVGIVAGGGRIDKPLLKAGRAFHKYRVKRNCWPRT
POM10069|RPL8-3      NVLPVGEMPEGTIISNVEEKAGDRGALGRSSGNYVIIVGHDVDTGKTRVKLPSGAKKVVPSSARGVVGIVAGGGRIDKPLLKAGRAFHKYRVKRNCWPRT
YST10068|RPL2A       NVLPLGSVPEGTIVSNVEEKPGDRGALARASGNYVIIIGHNPDENKTRVRLPSGAKKVISSDARGVIGVIAGGGRVDKPLLKAGRAFHKYRLKRNSWPKT
YST10069|RPL2B       NVLPLGSVPEGTIVSNVEEKPGDRGALARASGNYVIIIGHNPDENKTRVRLPSGAKKVISSDARGVIGVIAGGGRVDKPLLKAGRAFHKYRLKRNSWPKT
CIN10040|Rpl8        NVLPISQCPEGTIVCNIEEKVGDRGALARTSGNYATVIGHNPEDNKTRIRLPSGAKKTVSGHARATIGIVAGGGRIDKPLLKAGRAYHKYKAKRYNWPRT
NEA10039|Rpl8        NVLPIGQCPEGTIVCNVEEKIGDRGALARTSGNYATIIGHS-ETGVTRIRLPSGSKKTISSRCRATVGIIAGGGRIDKPFLKAGRKYHAMRAKRNSWPRT
MAY10039|Rpl8        NVLPLSSLPEGTIVCNVEEKSGDRGSLARTSGNYATIIGHDPNGKTSRIRLPSGAKKTVPSTSRATIGIVAGGGRIDKPLLKAGRAHHKFKVKRNSWPRT
RHI10148|Rpl8        NVMPLASMPEGTVICNVEEKVGDRGAIARTSGNYATIIGHG-DDGKTRIRLPSGSKKVIPSTSRAVVGIVAGGGRIDKPLLKAGRAYHKYRVKRNSWPKT
RHI10149|Rpl8-2      NVMPLASMPEGTVICNVEEKVGDRGAIARTSGNYATIIGHG-DDGKTRIRLPSGSKKVIPSTSRAVVGIVAGGGRIDKPLLKAGRAYHKYRVKRNSWPKT
RHI10150|Rpl8-3      NVMPLASMPEGTVICNVEEKVGDRGAIARTSGNYATIIGHG-DDGKTRIRLPSGSKKVIPSTSRAVVGIVAGGGRIDKPLLKAGRAYHKYRVKRNSWPKT
RHI10151|Rpl8-4      NVMPLASMPEGTVICNVEEKVGDRGAIARTSGNYATIIGHG-DDGKTRIRLPSGSKKVIPSTSRAVVGIVAGGGRIDKPLLKAGRAYHKYRVKRNSWPKT
ARA10108|RPL8A       NVLPLRSIPEGAVVCNVEHHVGDRGVLARASGDYAIVIAHNPDSDTTRIKLPSGSKKIVPSGCRAMIGQVAGGGRTEKPMLKAGNAYHKYRVKRNSWPKV
ARA10109|RPL8B       NVLPLGSIPEGAVICNVELHVGDRGALARASGDYAIVIAHNPESNTTRVKLPSGSKKILPSACRAMIGQVAGGGRTEKPFLKAGNAYHKYKAKRNCWPVV
ARA10110|RPL8C       NVLPLRSIPEGAVICNVEHHVGDRGVFARASGDYAIVIAHNPDNDTSRIKLPSGSKKIVPSGCRAMIGQVAGGGRTEKPMLKAGNAYHKYRVKRNCWPKV
RIC10123|RPL8A       NVLPIRSVPEGAVVCNVEHHVGDRGVFARASGDYAIVISHNPDNGTSRIKLPSGAKKIVPSSCRAMIGQVAGGGRTEKPMLKAGNAYHKYRVKRNCWPKV
GMA10195|LOC10079831 NVLPLRSIPEGAVICNVEHHVGDRGVFARASGDYAIVISHNPDNDTSRIKLPSGSKKIVPSGCRAMIGQVAGGGRTEKPLLKAGNAYHKFRVKRNCWPKV
GMA10196|LOC10080213 NVLPLRSIPEGAVICNVEHHVGDRGVFARASGDYAIVISHNPDNDTSRIKLPSGSKKIVPSDCRAMIGQVAGGGRTEKPLLKAGNAYHKFRVKRNCWPKV
GMA10197|LOC10052783 NVLPIRSIPEGAVICNVEHHVGDRGVFARASGDYAIVISHNPDNDTSRIKLPSGAKKIVPSGCRAMIGQVAGGGRTEKPLLKAGNAYHKFRVKRNSWPKV
GMA10198|rpL2        NVLPLRSIPEGAVICNVEHHVGDRGVFARASGDYAIVISHNPDNDTSRIKLPSGSKKIVPSDCRAMIGQVAGGGRTEKPLLKAGNAYHKFRVKRNCWPKV
POP10039|RPL8        NVLPLRSVPEGAVVCNVEHHVGDRGVFARASGDYAIVISHNPDNDTTRIKLPSGSKKIVPSGCRGMIGQVAGGGRTEKPMLKAGNAYHKFRVKRNCWPKV
CRE10039|RPL8        NVKPLGDMPEGTIVCNVEEKAGDRGALARCSGDYAIVVAHNPDTGITRIKLPSGAKKVVSSACRATVGQVAGGGRTEKPMLKAGRSYWKYKAKRNSWPKV
VOL10042|RPL8        NVKPLGDMPEGTIICNVEEKAGDRGALARCSGDYAIVVAHNPDAGITRIKLPSGAKKVVSSECRATVGQVAGGGRTEKPMLKAGRSYFKYKAKRNSWPKV
HEM10036|rpl8        NIVPLHSVPEGTICCNVEARQGDRGKFGRTSG-NHVTIINQLKNGKTRIRLPSGSKKIVSSHCRGMIGVVAGGNRIDKPLLKAGRAFFKYKAKRNCWPVV
PTR10041|RPL8        NVLPLSAVPEGTIVCNVEAKLGDRGAFARGSGAFAVVVSHDDDKGTTRLRLPSGGKKSVPSAVRAQIGIVAGGGRTDKPLLKAGRAYHKYSVKRNCWPKI
TPS10039|Rpl8        NVLPLKQVPEGTIVCNIEAKVGDRGAFARGSGCFAVVISHDEDKGTTRLRLPSGGKKTVSSNVRAQIGVVAGGGRTDKPLLKAGRAYHKYAVKRNCWPKI
CYA10040|RPL8        NTLPLSSMPEGTIVCNLETKEGDRGTLARASGMYAVVVNH-LENGKTRVRLPSGARRLVSSSCRATVGVVAGGGRTAKPILKAGRAYYKYKAKRNEWPRV
DIC10039|RPL8        NILPIGKLPEGTIICNVEEKLGDCGAVARCSGNYATIVSHNPDEGVTRIKLPSGSKKNVSSLARAMIGIVAGGGRIDKPMLKAGRAFHKYRVKKNNWPKV
PLA10045|RPL8        NILPIGKMPEGTLICNLEHRTGNRGTLVKASGCYATVVGQSEDGKKTKVRLPSGAKKTIDAKARAMVGVVGAGGRIDKPILKAGVAHHKYRVKRNCWPKV
TGO10039|RPL8        NILPLNKMPEGTVVSNVEEKAGDRGTLARTSGTYATIVGHSDDGSKTRIRLPSGARKTVSGYSRGMVGIVAGGGRIDKPMLKAGNAYHKYKVKRNCWPKV
GIA10039|Rpl8        NILPVGNIPEGTYVCNVEEKPMDRGCLARASGTYCLVVAHNMETNKTRIRLPSGQKKLISSKARAMIGLVAGGGRTDKPLLKAGNAYHKYKAKRNCWPVV


HUM10040|RPL8        RGVAMNPVEHPFGGGNHQHIGKPSTIRRDAPAGRKVGLIAARRTGRLRGTKTVQEKEN----
DOG10039|Rpl8        RGVAMNPVEHPFGGGNHQHIGKPSTIRRDAPAGRKVGLIAARRTGRLRGTKTVQEKEN----
MUS10039|Rpl8        RGVAMNPVEHPFGGGNHQHIGKPSTIRRDAPAGRKVGLIAARRTGRLRGTKTVQEKEN----
RAT10039|Rpl8        RGVAMNPVEHPFGGGNHQHIGKPSTIRRDAPAGRKVGLIAARRTGRLRGTKTVQEKEN----
CHK10040|Rpl8        RGVAMNPVEHPFGGGNHQHIGKPSTIRRDAPAGRKVGLIAARRTGRLRGTKTVQEKEN----
FUG10040|RPL8        RGVAMNPVEHPFGGGNHQHIGKPSTIRRDAPAGRKVGLIAARRTGRLRGTKTVQEKEN----
DAN10039|Rpl8        RGVAMNPVEHPFGGGNHQHIGKPSTIRRDAPAGRKVGLIAARRTGRLRGTKTVQDKEN----
MED10039|Rpl8        RGVAMNPVEHPFGGGNHQHIGKPSTIRRDAPAGRKVGLIAARRTGRLRGTKTVQEKEN----
CIO10039|RPL8        RGVAMNPVEHPFGGGNHQHIGSPSTVRRDASPGRKVGLIAARRTGRLRGSRVSKDKE-----
DRO10053|RpL8        RGVAMNPVEHPHGGGNHQHIGKASTVKRGTSAGRKVGLIAARRTGRIRGGKGDSKDK-----
MOS10039|Rpl8        RGVAMNPVEHPHGGGNHQHIGKASTVKRGTPPGRKVGLIAARRTGRIRGGKGDEKFKEKEKK
BEE10041|Rpl8        RGVAMNPVEHPHGGGNHQHIGKASTVKRGTSAGRKIGLIAARRTGRIRGGKTDTKKDD----
CEL10039|rpl-2       RGVAMNPVEHPHGGGNHQHIGHPSTVRRDASAGKKVGLIAARRTGRIRGGKPVKFTKEENV-
BMA10039|RPL8        RGVAMNPVEHPHGGGNHQHIGHPSTVKRGTSAGRKVGLIAARRTGRIRGGKPEKHGKEETV-
STE10039|RPL8        RGVAMNPVEHPHGGGNHQHIGHPSTVRRDTPAGRKVGLIAARRTGLLRGGQKILKGDKESE-
MBR10039|RPL8        RGVAMNPVEHPFGGGNHQHIGKPSTCKRDTPAGRKVGLIAARRTGRLRGGQSSGKDE-----
NEU10040|Rpl8        RGVAMNPVDHPHGGGNHQHIGKASTISRYAAQGQKAGLIAARRTGLLRGTQKTKE-------
GRI10039|Rpl8        RGVAMNPVDHPHGGGNHQHIGKASTISRYAAQGQKAGLIAARRTGLLRGTQKTKE-------
GRA10040|RPL8        RGVAMNPVDHPHGGGNHQHIGKASTISRYAAQGQKAGLIAARRTGLLRGTQKTKE-------
YAR10040|Rpl8        RGVAMNPVDHPHGGGNHQHIGKASTISREAVSGQKAGLIAARRTGLLRGTQKIKE-------
POM10067|RPL8-1      RGVAMNPVDHPHGGGNHQHVGHSTTVPRQSAPGQKVGLIAARRTGLLRGAAAVEN-------
POM10068|RPL8-2      RGVAMNPVDHPHGGGNHQHVGHSTTVPRQSAPGQKVGLIAARRTGLLRGAAAVEN-------
POM10069|RPL8-3      RGVAMNPVDHPHGGGNHQHVGHSTTVPRQSAPGQKVGLIAARRTGLLRGAAAVEN-------
YST10068|RPL2A       RGVAMNPVDHPHGGGNHQHIGKASTISRGAVSGQKAGLIAARRTGLLRGSQKTQD-------
YST10069|RPL2B       RGVAMNPVDHPHGGGNHQHIGKASTISRGAVSGQKAGLIAARRTGLLRGSQKTQD-------
CIN10040|Rpl8        RGVAMNPVDHPHGGGNHQHIGKASTMARSSVPGQKVGLIAARRTGLLRGTVKVKEV------
NEA10039|Rpl8        RGVAMNPVDHPHGGGNHQHIGHASTMARDAPAGQKAGLIAARRTGLLRGTQGKNVDNA----
MAY10039|Rpl8        RGVAMNPVDHPHGGGNHQHIGKPSTRSRFAPAGQKVGLIAARRTGLIRGTIKTKDA------
RHI10148|Rpl8        RGVAMNPVDHPHGGGNHQHIGKASTMARDSPAGQKVGLIAARRTGLLRGTKKVKDA------
RHI10149|Rpl8-2      RGVAMNPVDHPHGGGNHQHIGKASTMARDSPAGQKVGLIAARRTGLLRGTKKVKDA------
RHI10150|Rpl8-3      RGVAMNPVDHPHGGGNHQHIGKASTMARDSPAGQKVGLIAARRTGLLRGTKKVKDA------
RHI10151|Rpl8-4      RGVAMNPVDHPHGGGNHQHIGKASTMARDSPAGQKVGLIAARRTGLLRGTKKVKDA------
ARA10108|RPL8A       RGVAMNPVEHPHGGGNHQHIGHASTVRRDAPPGQKVGLIAARRTGRLRGQAAASAAKAD---
ARA10109|RPL8B       RGVAMNPVEHPHGGGNHQHIGHASTVRRDKSAGAKVGQIAARRTGRRRGAAATLAAKADY--
ARA10110|RPL8C       RGVAMNPVEHPHGGGNHQHIGHASTVRRDAPPGKKVGLIAARRTGRLRGQAAALASKAD---
RIC10123|RPL8A       RGVAMNPVEHPHGGGNHQHIGHASTVRRDAPPGQKVGLIAARRTGRLRGQAAATAAKADKAT
GMA10195|LOC10079831 RGVAMNPVEHPHGGGNHQHIGHASTVRRDAPPGQKVGLIAARRTGRLRGQAAATAAKADKTT
GMA10196|LOC10080213 RGVAMNPVEHPHGGGNHQHIGHASTVRRDAPPGQKVGLIAARRTGRLRGQAAATAAKADKA-
GMA10197|LOC10052783 RGVAMNPVEHPHGGGNHQHIGHASTVRRDAPPGQKVGLIAARRTGRLRGQAAATAAKADKTT
GMA10198|rpL2        RGVAMNPVEHPHGGGNHQHIGHASTVRRDAPPGQKVGLIAARRTGRLRGQAAATAAKADKA-
POP10039|RPL8        RGVAMNPVEHPHGGGNHQHIGHASTVRRDAPPGQKVGLIAARRTGRLRGQAAASAAKADKV-
CRE10039|RPL8        RGVAMNPVEHPHGGGNHQHIGHASTVRRSAPPGQKVGLIAARRTGRLRGTNVIKGAAQNE--
VOL10042|RPL8        RGVAMNPVEHPHGGGNHQHIGHASTVRRSAPPGQKVGLIAARRTGRLRGTNVVKAAAQNE--
HEM10036|rpl8        RGVAMNPVEHPHGGGNHQHIGHSSTVRRDAPPGRKVGLIGARRTGRLRGGKKKNELKINEL-
PTR10041|RPL8        RGVAKNPVEHPHGGGNHQHIGMPSTVARDRPAGRKVGLIGARRTGRLRGARKTAQDKD----
TPS10039|Rpl8        RGVAKNPVEHPFGGGNHQHIGRPSTVSKEAPAGRKVGLIGARRTGRLRGVKKLGQDKD----
CYA10040|RPL8        RGVAMNPVDHPHGGGNHQHVGHPTTVARGSVPGQKVGLIAARRTGRISGTRETRVKEE----
DIC10039|RPL8        RGVAMNPVEHPHGGGNHQHVGHATTTKRDDPAGKKVGLIAARRTGRLRGTKNISE-------
PLA10045|RPL8        RGVAMNPVEHPHGGGNHQHIGHPSTVSRSAPAGQKVGLIAARRTGLLRGAKKTKLVGKSEE-
TGO10039|RPL8        RGVAMNPVEHPHGGGNHQHIGHPSTVSRMAAPGQKVGLIAARRTGLLRGGRKTKLAGKSQE-
GIA10039|Rpl8        RGVAMNPVDHPHGGGNHQHIGVSSCVPRNAVPGQKVGLIAARRTGCSGGKRR----------