CLUSTAL W (2.1) Multiple Sequence Alignments
HUM10078|RPLP0       ---MPREDRATWKSNYFLKIIQLLDDYPKCFIVGADNVGSKQMQQIRMSLRGKA-VVLMGKNTMMRKAIRGHLEN--NPALEKLLP-----HIRGNVGFV
DOG10077|Rplp0       ---MPREDRATWKSNYFLKIIQLLDDYPKCFIVGADNVGSKQMQQIRMSLRGKA-VVLMGKNTMMRKAIRGHLEN--NPALEKLLP-----HIRGNVGFV
MUS10077|Rplp0       ---MPREDRATWKSNYFLRSSQLLDDYPKCFIVGADNVGSKQMQQIRMSLRGKA-VVLMGKNTMMRKAIRGHLEN--NPALEKLLP-----HIRGNVGFV
RAT10077|Arbp        ---MPREDRATWKSNYFLKIIQLLDDYPKCFIVGADNVGSKQMQQIRMSLRGKA-VVLMGKNTMMRKAIRGHLEN--NPALEKLLP-----HIRGNVGFV
FUG10078|RPLP0       ---MPRKDRATWKSNYFLKIIKLLDDYPKCFIVGADNVGSKQMQTIRLSLRDKA-VVLMGKNTMMRKAIRGHLEN--NPALEKLLP-----HIKGNVGFV
DAN10077|Rplp0       ---MPREDRATWKSNYFLKIIQLLDDYPKCFIVGADNVGSKQMQTIRLSLRGKA-VVLMGKNTMMRKAIRGHLEN--NPALERLLP-----HIRGNVGFV
CIO10077|RPLP0       ---MPREDRKTWKANYFVKLINLLDEYPKCFIVGADNVSSKQMQQIRTSLREKA-VVLMGKNTMMRKAIKGHLNN--NPDLERLLP-----HIRGNVGLV
DRO10097|RpLP0       ---MVRENKAAWKAQYFIKVVELFDEFPKCFIVGADNVGSKQMQNIRTSLRGLA-VVLMGKNTMMRKAIRGHLEN--NPQLEKLLP-----HIKGNVGFV
MOS10078|Rplp0       ---MGREDKATWKSNYFLKVVQLLDEYPRCFIVGADNVGSRQMQTIRMSLRGSA-IVLMGKNTMMRKAIRGHLEN--NQNLEKLLN-----HIKGNVGFV
BEE10079|Rplp0       ---MGREDKATWKSNYFTKLVQLLDDYPKCFIVGADNVGSKQMQQIRMSLRGNA-VVLMGKNTMMRKAIRGHIER--NAALEKLLP-----HIRGNVGFV
CEL10083|rpa-0       ---MVREDRSTWKANYFTKLVELFEEYPKCLLVGVDNVGSKQMQEIRQAMRGHA-EILMGKNTMIRKALRGHLGK--NPSLEKLLP-----HIVENVGFV
BMA10077|RPLP0       ---MGREDKATWKANYFVKIVELLEEYPKCFIVGVDNVGSKQMQEIRQAMRGHA-DILMGKNTMIRKAIRGHLQT--NPDLEKLLP-----HIVGNVGFV
STE10077|RPLP0       ---MVREDRATWKSNYFLKIIQYLDEYPKLFLVGVDNVGSKQMQTIRQSLRGQG-EVLMGKNTMIRKAIRGHLEN--NPDLEKLLP-----HIKGNIGFV
MBR10077|RPLP0       ---MVKVDRKTWKKLYFQRFYEYLEKFSRILIVHADNVGSKQMQDIRAALRGNC-ELLMGKNTMVRRALLDHEN----EIFHELLP-----HIKGNVGLL
NEU10078|Rplp0       -----MGGKSANKAGYFDKLKGLLEDYRSIFIVSVDNVSSQQMHEIRQSLRGEA-VVLMGKNTMVRRALKTFVAD--TPEYERLLP-----FVKGNVGFV
GRI10077|Rplp0       -----MGGKTGNKAGYFDKLKGLLEEYKSIFIVGVDNVSSQQMHEIRQSLRGEA-VVLMGKNTMVRRALKTFVSE--SPEYERLLP-----YVKGNVGFV
GRA10078|Rplp0       ------MGAKSNKSLYFDKLKGLLEKYTSIFIVEIDNVSSQQMHEIRHALRNKG-VVLMGKNTMVRRALKTFVAD--SPEYERLLP-----HVKGNVGFV
STA10077|Rplp0       -----MGGKKEFKVAYFEKLETLLKEYKSIFIVTVDNVSSQQMHEIRQSLRGDG-VVLMGKNTMVRRALKGLIND--SPEYERLLP-----HVRGNVGFV
YAR10079|RPLP0       ----MGGSTSIKKTEYFSKLKQLLQEYKSIFVVGVDNVSSQQMHEIRKTLRGRA-VVLMGKNTMVRRALREFEEE--LPEAAELLMP----LCRGNVGFV
POM10135|RPLP0       -----MAISKESKAQYFEKLRSLFEKYNSLFVVNIDNVSSQQMHTVRKQLRGTA-ELIMGKNTMIRRAMRGIIND--MPELERLLP-----VVRGNVGFV
YST10134|RPP0        -----MGGIREKKAEYFAKLREYLEEYKSLFVVGVDNVSSQQMHEVRKELRGRA-VVLMGKNTMVRRAIRGFLSD--LPDFEKLLP-----FVKGNVGFV
CIN10078|RPLP0       -----MGASRADKELYFEKLKELLATYPSIFIVNVDNVGSNQMHQIRVALRGKG-VVLMGKNTMVRRALRSILAE--NPQYERLLP-----HVKGNVGFV
NEA10077|Rplp0       -----MGATRANKELYFEKLRALIEKYPSIFVVNIDNVSSQQCHMIRQALRGKG-VVLMGKNTMVRRAIRTILPE--FPQFEKLMP-----FVKGNIGFV
MAY10077|Rplp0       ----MGGMPRATKEAWFEKLTELLEKYPSIFIVNIDNVSSQQMHQIRQSLRGKG-VVLMGKNTMARRALRMLIGD--NPDYERLLP-----HLKGNIGFV
RHI10296|RPLP0       ------MSKRESKAAYFQKLNDYLNTYQSIFIVNVDNVSSNQMHQIRVSLRGEA-TVLMGKNTMVRRALKGLIGE--RPELEKLLN-----FVKGNIGFV
RHI10297|RPLP0-2     ------MSKRESKAAYFQKLNDYLNTYQSIFIVNVDNVSSNQMHQIRVSLRGEA-TVLMGKNTMVRRALKGLIGE--RPELEKLLN-----FVKGNIGFV
ARA10214|RPP0A       --MAVKATKAEKKIVYDSKLCQLLNEYSQILVVAADNVGSTQLQNIRKGLRGDS-VVLMGKNTMMKRSVRIHADKTGNQAFLSLLP-----LLQGNVGLI
ARA10215|RPP0B       ---MVKATKAEKKIAYDTKLCQLIDEYTQILVVAADNVGSTQLQNIRKGLRGDS-VVLMGKNTMMKRSVRIHSENTGNTAILNLLP-----LLQGNVGLI
ARA10216|RPP0C       ---MVKATKAEKKIAYDTKLCQLIDEYTQILVVAADNVGSTQLQNIRKGLRGDS-VVLMGKNTMMKRSVRIHSENSGNTAILNLLP-----LLQGNVGLI
RIC10264|RPP0B       --MAIKRTKAEKKVAYDKKLCQLLDEYTKVLIAVADNVGSNQLQEIRKGLRGDS-IVLMGKNTLIRRCIKVHADNTGNKEFLELMP-----LLVGNVGLI
RIC10265|RPP0A       --MAIKRTKAEKKVAYDKKLCQLLDEYTKVLIAVADNVGSNQLQEIRKGLRGDS-IVLMGKNTLIRRCIKVHADNTGNKDFLELMP-----LLVGNVGLI
RIC10266|RPP0C       --MAIKRTKAEKKVAYDKKLCQLLDEYTKVLIAVADNVGSNQLQEIRKGLRGDS-IVLMGKNTLIRRCIKVHADNTGNKDFLELMP-----LLVGNVGLI
GMA10392|LOC547816   --MAPKQTKAEKKIAYDAKLCDLMEEYGQILVVNSDNVGSNQLQNIRKGLRGDS-VVLMGKNTMMKRSVRMHAEKTGNNAYLNLIP-----LLVGNVGLI
GMA10394|LOC10077748 --MAPKQTKAEKKIAYDAKLCDLMEEYGQILVVNSDNVGSNQLQNIRKGLRGDS-VVLMGKNTMMKRSVRMHAEKTGNNAYLNLIP-----LLVGNVGLI
GMA10395|LOC10079196 --MARKLTKAQKKIAYDAKLCKLLDNYTQILVVAADNVGSNQLQNIRHGLRGDS-VILMGKNTMMKRSIKIHAQNTGDTTILNLIP-----LLVGNVGLI
POP10078|RPLP0       --MVNKLSKADKKIAYDAKLCQLLDEYSQILIAAADNVGSTQLQNIRRGLRGDS-VVLMGKNTMMKRSVRIHSEKTGNKAFLNLIP-----LLQGNVGLI
CRE10077|RPLP0       --MVAEERVSDKKKEYRQRLNQYLQTYDKAFIVHADNVGSRQFMDIRKALRPGA-VILMGKNTMMRFCVEKYLEETGDHRWECLVKPGKKGLLEGNVGIV
VOL10082|RPLP0       --MVAEERVSQKKKDYRKRLAQYLQTYDKAFIVNADNVGSKQFMDIRKALRPNS-VILMGKNTMMRYCVEKYLEETGDHRWECLVKPGKKGLLEGNVGIV
HEM10065|rla0        ------MANLNQKSLYFEKLAFLFSKYPKIIIVQADNVGSNQIQKCRKALQKSS-ILIMGKNSIIKKVLKKQIEK--NPNMQDLYD-----FTTGNVGLI
PTR10080|RPLP0       -----MPLSTERKAEYFERLKSMLTQYSKAFIVEVDNVGSKQLQMTRRGLRGKA-EVLMGKNTMMRKCMKEFVAENPGTPVEKLIE-----TCRGNVGFV
TPS10078|Rplp0       -----MPLSAERKQQYFSTMKELMTTYSKCFIVEIDNVGSMQIQQTRLALRGKA-EVLMGKNTMMRKCIREFVEENPDTPIAQLEA-----CCRGNVGFV
CYA10078|RPP0        -----MPSKQERKGAYIVKAGQLFDTYDKILVVEIDNVGSKQLQDARRELRALDSVILCGKNTVIRKTLKDRVSR--KPALEKVLH-----ALRGNVSFV
DIC10077|RPLP0       ----MSGAGSKRKNVFIEKATKLFTTYDKMIVAEADFVGSSQLQKIRKSIRGIG-AVLMGKKTMIRKVIRDLADS--KPELDALNT-----YLKQNTCII
PLA10081|RPLP0       ---MAKLSKQQKKQMYIEKLSSLIQQYSKILIVHVDNVGSNQMASVRKSLRGKA-TILMGKNTRIRTALKKNLQA--VPQIEKLLP-----LVKLNMGFV
TGO10077|RPLP0       --MAGPKGKSDKRKTYFSRLFALLEKYPRVLVVEADHVGSKQMADIRLALRGKA-VVLMGKNTMIRTALKQKMSE--MPQLEKLLP-----LVRLNVGFI
GIA10077|Rplp0       MSAAPLTAKQARRQAYVAKLERCLTEYKKIVLVSVDNVRSFQIAQIRRLLRGKA-ELLAGKNTIIKRVINQLDDDK----LKNLLP-----YIKLNVAFV


HUM10078|RPLP0       FTKEDLTEIRDMLLANKVPAAARAGAIAPCEVTVPAQNTGLGPEKTSFFQALGITTKISRGTIEILSDVQLIKTGDKVGASEATLLNMLNISPFSFGLVI
DOG10077|Rplp0       FTKEDLTEIRDMLLANKVPAAARAGAIAPCEVTVPAQNTGLGPEKTSFFQALGITTKISRGTIEILSDVQLIKTGDKVGASEATLLNMLNISPFSFGLII
MUS10077|Rplp0       FTKEDLTEIRDMLLANKVPAAARAGAIAPCEVTVPAQNTGLGPEKTSFFQALGITTKISRGTIEILSDVQLIKTGDKVGASEATLLNMLNISPFSFGLII
RAT10077|Arbp        FTKEDLTEIRDMLLANKVPAAARAGAIAPCEVTVPAQNTGLGPEKTSFFQALGITTKISRGTIEILSDVQLIKTGDKVGASEATLLNMLNISPFSFGLII
FUG10078|RPLP0       FTKEDLAEVRDLLLANKVPAAARAGAIAPCDVTVPGQNTGLGPEKTSFFQALGITTKISRGTIEILSDVGLIKLGDKVGASEATLLNMLNISPFSYGLII
DAN10077|Rplp0       FTKEDLTEVRDLLLANKVPAAARAGAIAPCEVTVPAQNTGLGPEKTSFFQALGITTKISRGTIEILSDVQLIKPGDKVGASEATLLNMLNISPFSYGLII
CIO10077|RPLP0       FTKEDLIETRDLLLANKVAAPARAGAVAPNDVIVPAQNTGLGPEKTSFFQALAIPTKISRGTIEIISDVHLIKPGDKVGASDATLLSMLKIFPFTYGLEI
DRO10097|RpLP0       FTKGDLAEVRDKLLESKVRAPARPGAIAPLHVIIPAQNTGLGPEKTSFFQALSIPTKISKGTIEIINDVPILKPGDKVGASEATLLNMLNISPFSYGLIV
MOS10078|Rplp0       FTKGDLAEIRDKLTESKVRAPARAGAIAPLEVVIPAQNTGLGPEKTSFFQALSIPTKISKGTIEIINDVPILKPGDKVGASEATLLNMLNISPFSYGLQI
BEE10079|Rplp0       FTRGDLIEVRDKLLENKVRAPARAGAIAPLSVIIPAQNTGLGPEKTSFFQALSIPTKISKGTIEIINDVHILKPGDKVGASEATLLNMLNISPFSYGLLV
CEL10083|rpa-0       FTKEDLGEIRSKLLENRKGAPAKAGAIAPCDVKLPPQNTGMGPEKTSFFQALQIPTKIARGTIEILNDVHLIKEGDKVGASESALLNMLGVTPFSYGLVV
BMA10077|RPLP0       FTNGDLSEIRAKLLENRRGAPAKAGAIAPCDVKLPPQNTGMGPEKTSFFQALQIPTKISRGTIEILNEVHLIKTGEKVGASESALLNMLNIMPFSYGLVV
STE10077|RPLP0       FTKEDLADVRKIIMENKVAAPAKAGVIAPIDVFVPAGNTGLGPEKTSFFQALAIPTKIARGTIEIINDVHLIKKDEKVGASESTLLNMLKISPFSYGLQI
MBR10077|RPLP0       FTNDDFVAIRDVLLDHKVAAPARVGAIAPEPIIIPAGPTGQDAQKTSFFQALNIPTKIAKGSIEIISEVRLLEEGGRVGPSEAALLNMLGISPFSYGLVV
NEU10078|Rplp0       FTNGDLKEVRDKILANKVAAPARAGAIAPADVWIPAGNTGMEPGKTSFFQALGVPTKIARGTIEITTDLKLVEAGAKVGPSEATLLNMLNISPFTYGMGI
GRI10077|Rplp0       FTNSDLKEIRDKILQNRVRAPARAGAVAPDDVWIPAGNTGMEPGKTSFFQALGVPTKIARGTIEITTDLKLVEAGGKVGASEATLLNMLNISPFTYGLTV
GRA10078|Rplp0       FTNEDLKEVRDVILANKVAAPARAGALAPADVWVPAGNTGMEPGKTSFFQALGVPTKIARGTIEITTDLKLVEAGSKVGPSEATLLNMLNISPFTYGMGI
STA10077|Rplp0       FTNADLKETRDKILSNRVAAPARAGALAPLDVFVPAGNTGMEPGKTSFFQALGVPTKIARGTIEITADLKLIEAGNKVGASEATLLNLLNISPFTYGMGI
YAR10079|RPLP0       FTNDDLKEIREVLLENRVLAPARAGAIAPKDVWIQAANTGMPPDKTSFFQALGVPTKISRGTIEITSDVKILQQDVKVGPSEATLLNMLNISPFTYGMTV
POM10135|RPLP0       FTNADLKEVRETIIANVIAAPARPNAIAPLDVFVPAGNTGMEPGKTSFFQALGIPTKITRGTIEITSDVHLVSKDAKVGPSEATLLNMLNISPFTYGMDV
YST10134|RPP0        FTNEPLTEIKNVIVSNRVAAPARAGAVAPEDIWVRAVNTGMEPGKTSFFQALGVPTKIARGTIEIVSDVKVVDAGNKVGQSEASLLNLLNISPFTFGLTV
CIN10078|RPLP0       FTSEDLKEVREIIVANKVAAPARAGALAPVDVSVPAGNTGMEPGKTSFFQALGIPTKIARGTIEIVSDVKVVFAGTRVGPSEAALLNMLNISPFTYGMTV
NEA10077|Rplp0       FTSGDLKDVREIIIANKVAAPARAGAFAPNDVYVPAGNTGMEPGKTSFFQALGIPTKIARGTIEIVSDVQVVAAGSKVGPSEATLLNMLNISPFTYGMTV
MAY10077|Rplp0       FTSGDLKDVRDVILSNRVAAPARAGAYAPADIFVKAGNTGMEPGKTSFFQALGVPTKIARGTIEIVSDVKVVDAGNRVGTSEATLLNMLNISPFTYGMTV
RHI10296|RPLP0       FTNGDLKDIRTKIVSNRVAAPARAGAVAPADVIVPAGNTGMEPGKTSFFQALGIPTKIARGTIEIVSDVSLVQAGEKVGASEATLLNMLNISPFTYGMGV
RHI10297|RPLP0-2     FTNGDLKDIRNKIVSNRVAAPARAGAVAPADVIVPAGNTGMEPGKTSFFQALGIPTKIARGTIEIVSDVSLVQAGEKVGASEATLLNMLNISPFTYGMGV
ARA10214|RPP0A       FTKGDLKEVSEEVAKYKVGAPARVGLVAPIDVVVQPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAKLGIRPFSYGLVV
ARA10215|RPP0B       FTKGDLKEVSEEVAKYKVGAPARVGLVAPIDVVVQPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKQGDKVGSSEAALLAKLGIRPFSYGLVV
ARA10216|RPP0C       FTKGDLKEVSEEVAKYKVGAPARVGLVAPIDVVVQPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKQGDKVGSSEAALLAKLGIRPFSYGLVV
RIC10264|RPP0B       FTKGDLKEVREEVAKYKVGAPARVGLVAPVDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSESALLAKLGIRPFSYGLVI
RIC10265|RPP0A       FTKGDLKEVREEVAKYKVGAPARVGLVAPVDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSESALLAKLGIRPFSYGLVI
RIC10266|RPP0C       FTKGDLKEVREEVAKYKVGAPARVGLVAPVDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSESALLAKLGIRPFSYGLVI
GMA10392|LOC547816   FTKGDLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSYGLVV
GMA10394|LOC10077748 FTKGDLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAKLGIRPFSYGLVV
GMA10395|LOC10079196 FTKGDVKEVKEVVSKYKVAAPARVGLVAPIDVIVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIVTPVELIMKGDKVGSSEAVLLSKLAIRPFSYGLAV
POP10078|RPLP0       FTKGDLKEVSEEVAKYKVGAPARVGLVAPIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAKLGIRPFSYGLVV
CRE10077|RPLP0       FTNGDLSQVKDEIAKYKVGAPARVGAVAPEDVVIKAGGTGMDPSQTSFFQALGIATKINKGTIEIVSDVVVVKAGERVGPSQATLLAKLGVKPFKYGLLI
VOL10082|RPLP0       FTNGDLSQVKDEIAKYKVGAPARVGATANEDVVIKAGGTGMDPSQTSFFQALGIATKINKGTIEIVSDVVVVKTGDRVGASQATLLAKLGIKPFKYGLQI
HEM10065|rla0        FTKNDPFEIKKILKENRIPAPAKVGQIAQNEVIIPAGPTELPPDGTSFFQALNIPTKIQKGQIEIQDPIKLIEKGKVVGNSEAALLKKLNIVPFSFELQI
PTR10080|RPLP0       FTNGDLGEIREVLESNTRPAPARVGSVAPINVVVPKGPTGCDPGQTAFFQTLQIATKITRGQIEMVNDTALIQAGDRVTASQAALLLKLDIEPFTYGLVL
TPS10078|Rplp0       FTNGDLGAVREVLESNVRPAPARVGAVAPIDVIVPKGPTGCDPGQTAFFQTLQIATKITKGQIEMTTDTHLISAGERVTASQAALLQKLAMEPFTYGLVL
CYA10078|RPP0        FTRGDLREVRDCILRNKVPAPAKAGQIAQCDVFVPAGPTGMPPDMTSFFQALSIPTKIERGSICIVSDVQVIKQNERVSASAVALLQRMGIEPFTYGMKI
DIC10077|RPLP0       FCKDNIAEVKRVINTQRVGAPAKAGVFAPNDVIIPAGPTGMEPTQTSFLQDLKIATKINRGQIDIVNEVHIIKTGQKVGASEATLLQKLNIKPFTYGLEP
PLA10081|RPLP0       FCKDDLSEIRNIILDNKSPAPARLGVIAPIDVFIPPGPTGMDPSHTSFFQSLGISTKIVKGQIEIQEHVHLIKQGEKVTASSATLLQKFNMKPFSYGVDV
TGO10077|RPLP0       FCIEDPAEVRRIVAENKVPAPARQGVFAPIDVFIPAGPTGMDPGSTSFFQALGIATKIVKGQIEIQNEVHLIKEGDKVTASAATLLQKLNIKPFEYGLAI
GIA10077|Rplp0       FTNGDTSAILKAFKKTKRKAAAKAGIVAPADVVIEPMLTQSGPDQHGFYAALGIDTKINKGKIEIVNPVNLIKKGDIVTPSHATLLQRLEIDPFFYAMSA


HUM10078|RPLP0       QQVFDNGSIYNPEVLDITEETLHSRFLEGVRNVASVCLQIGYPTVASVPHSIINGYKRVLALSVETD-YTFPLAEKVKAFLADPSA----FVAAAPVAAA
DOG10077|Rplp0       QQVFDNGSIYNPEVLDITEETLHSRFLEGVRNVASVCLQIGYPTVASVPHSIINGYKRVLALSVETD-YTFPLAEKVKAFLADPSA----FVAAAPVAAA
MUS10077|Rplp0       QQVFDNGSIYNPEVLDITEQALHSRFLEGVRNVASVCLQIGYPTVASVPHSIINGYKRVLALSVETE-YTFPLTEKVKAFLADPSA----FAAAAPAAAA
RAT10077|Arbp        QQVFDNGSIYSPEVLDITEQALHTRFLEGVRNVASVCLQIGYPTVASVPHSIINGYKRVLALSVETD-YTFPLAEKVKAFLADPSA----FAAAAPVAAA
FUG10078|RPLP0       QQVYDNGSVYSPEVLDITEASLHARFLEGVRNVASVCLEIGYPTLASVPHTVINGYKNVLAVTVETG-YSFPLADKVKAYLADPSA----FASAAPAAAA
DAN10077|Rplp0       QQVYDNGSVYSPEVLDITEDALHKRFLEGVRNIASVCLQIGYPTLASIPHTIINGYKRVLAVTVETD-YTFPLAEKVKAYLADPTA----FAVAAPVAAA
CIO10077|RPLP0       EQVYDSGSVFSPEVLDITDDDIRRKFTNAVRNVASVCLAIGYPTVASAPHSIINGFKNILAVAAETE-ITFPEAEKMKAYLADPTA----FAVAAAPAAS
DRO10097|RpLP0       NQVYDSGSIFSPEILDIKPEDLRAKFQQGVANLAAVCLSVGYPTIASAPHSIANGFKNLLAIAATTE-VEFKEATTIKEYIKDPSK----FAAAASASAA
MOS10078|Rplp0       QQVYDSGSIFSPEILDIKAEDLRAKFQAGVANLAAVSLQIGYPTLASVPHSIANGFRNLLAIAAVTE-VEFKEAETVKEFIKDPSK----FAAATATTAS
BEE10079|Rplp0       EQVYDSGTIFAPEILDIKPEDLCEKFMAGVANLAAVCLAIGYPTIASAPHSIANGFKNLLAIAAVTD-IEFPEATTIKEYIKDPSK----FAATVSVAAP
CEL10083|rpa-0       RQVYDDGTLYTPEVLDMTTEELRKRFLSGVRNVASVSLAVNYPTLASVAHSLANGLQNMLGVAAVTD-VSFKEAETIKAFIADPSK----FAAAAPAAAA
BMA10077|RPLP0       RQVYENGTVFAPEVLDMTPDDIRAKFLKGVQNVAAVSLAIGHPTLASIPHSIANAFKNLLAIAVEAN-IEMKEAEKIKEFLADPTK----FAAPVVATAS
STE10077|RPLP0       CQVYESGSVYDPSVLDITNDDILARFRMGIANVASVCLEIGYPTVVSVPHSIINGFKNIAAVAVETD-IEFPQVEKLKAFLADPSA----FAVAAPAAET
MBR10077|RPLP0       VQIYENGACFNPKILDITNDDLVAKFMEGSRKVAAVSLAIGRPNPASVPHMVINGYKNVLAIACVTE-ITFPLAEKAKAYLANPEA----FAVAAAPAAA
NEU10078|Rplp0       AQVYDQGNTFPSDVLDISEEQLLKAFSTAITTIASLSLALNFPTLPSVIHSVVNAYKKVLAVAIETE-ISWPEIEELKDRIANPEA----YASAAPAAS-
GRI10077|Rplp0       EQVYDQGNCFPSSVLDIGEEQLLKSFSSAIATIAAISLALDFPTWPSVIHSVVNSYKNILSIALETE-YSFPAVEELKDRIANPDA----YASAAPAAG-
GRA10078|Rplp0       SQVYDQGQTFPPSVLDVGEEQLLKTLSQAIATIATISLALNFPTLPSVLHSLVNSYKKVLAVAVVTE-VSWPEIEQLKDRIANPDA----YASAAPAAA-
STA10077|Rplp0       YQIYDNGQTFEASVLDIEESQLLKAFSSAIATIASISLATGFPTLPSVMHSVVNSYKKVLAVAIETD-YEWEEIAELKDRIANPDK----YASAGPAAGG
YAR10079|RPLP0       VQVYDNGQVFGSEILDITDEELISNVIGAISTITAISLAANYPTLPAVSHCIINNYKNVLALSIASD-YTFEGSEAIKDRIANPEA----YAAAAPAAA-
POM10135|RPLP0       LTIYDQGNVFSPEILDVSEEDLIGHLLSAASIITAISLGANYPTILSVMHSVVNAYKNLVAVSLATE-YTFEGTEQTKAFLADPSA----FVVAAAPAA-
YST10134|RPP0        VQVYDNGQVFPSSILDITDEELVSHFVSAVSTIASISLAIGYPTLPSVGHTLINNYKDLLAVAIAAS-YHYPEIEDLVDRIENPEK----YAAAAPAAT-
CIN10078|RPLP0       IQIYDRGNTFPASVLDVEESELVERFLTGIKTIAAISLAINYPTIASITHSLVNAYKNLLAVSIATD-YTFEGSEKIKEYIANPEA----FAVAAAPAA-
NEA10077|Rplp0       VQVYDNGAVFPSSILDIEEKTLIDQFVSGIKTVAAISLATGIPTIASVMHSLVNSYKNILNISLATD-YEFEGSAKIKEYLANPEA----FAVAAAPAA-
MAY10077|Rplp0       VQIYDRGQCFESSVLDVSEDELVDRFVLGIKQVACISLALNYPTIASVMHSLVNGYKNLIAVSLATD-YEFDGSKKAKEYLANPEA----FAAAAPVAA-
RHI10296|RPLP0       VQVFDKGTVFSPEVLDVEESALVGKLMSAIREIASISLAVGYPTLASVPHSVINGYKNLLAVSVASD-YTFPGSEQLKEFIANPDA----FAVAAPAAA-
RHI10297|RPLP0-2     VQVFDKGTIFSPEVLDVEESALVAKLMSAIREIASISLAVGYPTLASVPHSVINGYKNLLAVSVASD-YTFPGSEQLKEFIANPDA----FAVAAPAAA-
ARA10214|RPP0A       ESVYDNGSVFNPEVLNLTEDDLVEKFAAGVSMITALSLAISYPTVAAAPHMFLNAYKNVLAVALATE-YSFPQAENVKEFLKDPTK----FAVAVAAPVS
ARA10215|RPP0B       QSVYDNGSVFSPEVLDLTEDQLVEKFASGISMVTSLALAVSYPTLAAAPHMFINAYKNALAIAVATE-YTFPQAEKVKEYLKDPSK----FAVASVAAVS
ARA10216|RPP0C       QSVYDNGSVFSPEVLDLTEDQLVEKFASGISMVTSLALAVSYPTLAAAPHMFINAYKNALAIAVATD-YTFPQAEKVKEFLKDPSK----FVVAAAAVSA
RIC10264|RPP0B       TNVYDSGSVFSPEVLDLTEDDLMEKFASGVSMVASVSLAISYPTIAAAPHMFLNGYKNVLAVAVETE-YSYPHADKIKEYLKDPSK----FAVAAP--VA
RIC10265|RPP0A       TNVYDSGSVFSPEVLDLTEEDLMEKFASGVSMVASVSLAISYPTIAAAPHMFLNGYKNVLAVAVETE-YSYPHADKIKEYLKDPSK----FAVAAP--VA
RIC10266|RPP0C       TNVYDSGSVFSPEVLDLTEEDLMEKFASGVSMVASVSLAISYPTIAAAPHMFLNGYKNVLAVAVETE-YSYPHADKIKEYLKDPSK----FAVAAA--VA
GMA10392|LOC547816   LSVYDNGSVFSPEVLDLTEDDLIGKFAAGVSMVTSLSLAISYPTLAAAPHMFVNAYKNVLAVAVETD-YSFPEADKVKEYLKDPSK----FAVAAVAAPA
GMA10394|LOC10077748 LSVYDNGSVFSPEVLDLTEDDLIEKFAAGVSMVTSLSLAISYPTLAAAPHMFVNAYKNVLAVAVETD-YSFPEADKVKEYLKDPSK----FAVAAVAAPA
GMA10395|LOC10079196 VSVYDNGSVFSPEVLDLTEDDLVVKFAEGVCMVSSLSLAISYPSIAAAPHMFVNSYKNILAVAVATE-YSFPEADKVKEYLKDPSK----FAVAVVAAPA
POP10078|RPLP0       LSAYDNGSVFSPEVLDLTEDDLIDKFAAGVSMIASLSLATSYPTLAAAPHMFINAYKNVLAVAVATE-YSFPQAEKVKEFLEDPSK----FAVAAAPVTA
CRE10077|RPLP0       LKVIESGAVYDPKVMDITDEDMMASVIAGIREVAALSLGAQYPTLAAAPHVIIDGYKNVLAIAVETD-YTFPLAQKVKDYLADPSK----FASAAP-AAA
VOL10082|RPLP0       LKVIESGAVYDPKVMEITDEDILSSVMTAIREVSALSLGARYPTLVAAPHVIIDGYKNVLAIALETD-YTFPLAQKVKDYLADPSK----FAAAAAPAAG
HEM10065|rla0        KLVFDTDVCYKPTVLEITKEQLTESSLAIFSKLNLVAYSISYPTRFTIKNTIKKISTNLTLISHVIG-YKPPKKNDYDDKNPILEK-------NKEEFPK
PTR10080|RPLP0       KKVYDNGSLFDAKILEITDDVLASKFVGALNMIASLSLAMGFPTQASVPHSIANAYKAILAVTIQLENYSFDKADQVKEYLASE----------------
TPS10078|Rplp0       KSVYDSGSLFDAKVLDITDDVLAAKFVSALNTISKLSLALNIPTQASVTHSIANAFKAILSVTVELENYSFDKADIYKAYLADPSA----FAGSGGGGGG
CYA10078|RPP0        RQIYEEGAMYEPSVLDITPDDLRNKVREAVDTIAAISLATGYLTAPAVPHLLVRAAKDLVAASIAAD-YDMPQSRSLRELLSDPSKLEELVAAASIGAAG
DIC10077|RPLP0       KIIYDAGACYSP---SISEEDLINKFKQGIFNIAAISLEIGYPTVASIPHSVMNAFKNLLAISFETS-YTFDAAEKFKSAAA---------------AAP
PLA10081|RPLP0       RTVYDDGVIYDAKVLDITDEDILEKFSKGVSNVAALSRATGVITEASYPHVFVEAFKNIVALIIDSD-YTFPLMENIKKMVENPEA----FAAVAAPASA
TGO10077|RPLP0       QHVYDDGSVYKASVLDITDEVILEKFRAGTMNVAALSREVGFPTTASAPHSILEAFKFCTSLVLESD-YSFPQMQRIKDILENPEA----FAAVAAAAAP
GIA10077|Rplp0       LNLYDDGEIYDAAVLEIDDSVMEAKWNAGLEAFVSLALGANFPCLPAIPHIFMDTAKSFIGAGVEADVTEIPLVKRVKEILADPSK----FAVAAPAAAT


HUM10078|RPLP0       TTAAPAAAAAPAKVEAKE---ESEESDEDMGFGLFD------
DOG10077|Rplp0       TTAAPAAAAAPAKVEAKE---ESEESDEDMGFGLFD------
MUS10077|Rplp0       TTAAPAAAAAPAKAEAKE---ESEESDEDMGFGLFD------
RAT10077|Arbp        TTAAPAAAAAPAKVEAKE---ESEESDEDMGFGLFD------
FUG10078|RPLP0       VT---AAAPAAAKEEVKE---ESEESDDDMGFGLFD------
DAN10077|Rplp0       TEQK-SAAPAAKEEAPKE---ESEESDEDMGFGLFD------
CIO10077|RPLP0       DEKKEEAKPAEESEE---------ESDDDMGFGLFD------
DRO10097|RpLP0       PAAGGATEKKEEAKKPES---ESEEEDDDMGFGLFD------
MOS10078|Rplp0       AAAP---AAKAEEKKVES---ESEDEDEDMGFGLFD------
BEE10079|Rplp0       VVSSTETPAAEKKEEKKE---ESESEDEDMGFGLFD------
CEL10083|rpa-0       APAAAAPAAKKEEPKEE--------SDDDMGFGLFD------
BMA10077|RPLP0       TAPSAESVKPEESSKKEEAKKEESSEDEDMGFGLFD------
STE10077|RPLP0       TAP----AAAEEKKAEPE---EEEESDDDMGFGLFD------
MBR10077|RPLP0       AAPAAAAAAAPEPESEDD--------EEMDGFSLFD------
NEU10078|Rplp0       --TEAAPAAGKAEEKEEE--KEESDEDDGGFGGLFD------
GRI10077|Rplp0       --GAGGGDAPAAEAKKDE--SEEEQSDEDMGFGLFD------
GRA10078|Rplp0       --ASGGDAPAAEEAKKDE--SEE-EEDDEGFGGLFD------
STA10077|Rplp0       AAASSGGAEAAKAEEKEE--EKEESEDDDMGFGLFD------
YAR10079|RPLP0       ---AASGSSEAAPAAAAE--EDEESEDDDMGFGLFD------
POM10135|RPLP0       ---AAGGEAEAPAAEAAA--EEEEESDEDMGFGLFD------
YST10134|RPP0        ---SAASGDAAPAEEAAA--EEEEESDDDMGFGLFD------
CIN10078|RPLP0       ---AAAADAPKAEEAKVE--EE-EESDEDMGFDLFG------
NEA10077|Rplp0       ---AAEASSEAAPAAAKE--EEKEESDDDMGFGLFD------
MAY10077|Rplp0       ---AADSGAAAAVEEEKE--EEKEESDDDMGFGLFD------
RHI10296|RPLP0       ---AAESSAPAAEEKAEE--EESEDED--MGFGLFD------
RHI10297|RPLP0-2     ---AAESSAPAAEEKAEE--EESEDED--MGFGLFD------
ARA10214|RPP0A       GESGG--AVVAVAVEEEA-AE---ESDGDMGFDLFG------
ARA10215|RPP0B       ADAGG---GAPAAAKVEE-KEESDEEDYGGDFGLFDEE----
ARA10216|RPP0C       DAGGGSAQAGAAAKVEEK-KEESDEEDYEGGFGLFDEE----
RIC10264|RPP0B       ADSG-AAAPSAAKEEEKK-EEPEEESDGDLGMSLFD------
RIC10265|RPP0A       AADSGAAAVASSKEEEKK-EEPEEESDGDLGMSLFD------
RIC10266|RPP0C       AADSGAAAPAASKEEEKK-EEPEEESDGDLGMSLFD------
GMA10392|LOC547816   AASGA--PAAAAKEEEKK-EEPAEESDDDMGFSLFD------
GMA10394|LOC10077748 AESGA--PAAAK-EEEKK-EEPAEESDDDMGFSLFD------
GMA10395|LOC10079196 TKSGA--APAAASKVEEK-KEEADESDDDMGFSLFD------
POP10078|RPLP0       AASGG--APAAAKEEEKK-EEPAEESDDDMGFSLFD------
CRE10077|RPLP0       AGGAP------AAKKEEP-KKEEPSEEEDMGFSLFD------
VOL10082|RPLP0       AAAAA------PAAKEEP-KKEEPSEEEDMGFSLFD------
HEM10065|rla0        NEPENDIQEPKNNKEENE-----ENSEEDFGLGLFD------
PTR10080|RPLP0       ------------------------------------------
TPS10078|Rplp0       GGDGGETSAAAAVEEVEEEEAPPAVDMFGGGDGGGGDY----
CYA10078|RPP0        AAGTASAEDTAAASGAAETKEAAEESDEDLGFGLFD------
DIC10077|RPLP0       VAAAPSAAAPAAAAKKVVVEEKKEESDDDMGMGLFD------
PLA10081|RPLP0       AKADEPKKEEAKKVEEEE-------EEEEDGFMGFGMFD---
TGO10077|RPLP0       AAGAAAAAEAPKEEEPEE-------EEDDMGFSLFD------
GIA10077|Rplp0       AAAAAP--EEAKKEESDDDEIVGAGGMFGGDSSSSEEESSSD