CLUSTAL W (2.1) Multiple Sequence Alignments
HUM10080|RPLP2       --MRYVASYLLAALGGNSSPSAKDIKKILDSVGIEADDDRLNKVISELNGK--NIEDVIAQGIGKLASVPAGGA--VAVSAAPGSAAPAAGSAPAAAEEK
DOG10079|Rplp2       --MRYVASYLLAALRGNTSPSAKDIKKIGDSVGIEADDDRLNKVISELNGK--NIEDVIAQGIGKLASVPAGGA--VAVSAAPGSAAPAAGAAPAAAEEK
MUS10079|Rplp2       --MRYVASYLLAALGGNSSPSAKDIKKILDSVGIEADDDRLNKVISELNGK--NIEDVIAQGVGKLASVPAGGA--VAVSAAPGSAAPAAGSAPAAAEEK
RAT10079|LOC368019   --MRYVASYLLAALGGNSNPSAKDIKKILDSVGIEADDERLNKVISELNGK--NIEDVIAQGVGKLASVPAGGA--VAVSAAPGSAAPAAGSAPAAAEEK
CHK10081|Rplp2       --MRYVAAYLLAVLGGNESPTSKDLKKILDSVGIETDDERLNKVISELNGK--NIEDVIAQGNGKLASMPAGGA--VAVSTGGVSAAPAAGAAPAAAEEK
FUG10080|RPLP2       --MRYVAAYLLAALGGNASPSAKDIKTILGSVGIEADDERLNKVIGELNGK--DINEVMNSGLSKLASVPAGGA--VAVPAAAAGGS--GGAAPAAAEEK
DAN10079|Rplp2       --MRYVAAYLLAALGGKDSPSTGDIKKILESVGIEADDVRMSKVVAELNGK--NVEEVIAQGFSKLASVPSGGA--VAVSSAAAPSSGGSAAAPAAEE-K
MED10079|Rplp2       --MRYVAAYLLAALGGNTSPSAKDIKDILGSVGIEADDERLNKVIGELNGK--NINEVVNSGLSKLASVPAGGA--VAAPAAAPSGA--TGAAPAPAEEK
CIO10079|RPLP2       --MRYVAAYLLAALGGNESPSSSDIKNILGSVGIDVDDDKLNMVIKELKGK--NLEEVIAAGNEKLASVPSG------GGGAVAASG--GAEAADEAPKE
DRO10098|RpLP2       --MRYVAAYLLAVLGGKDSPANSDLEKILSSVGVEVDAERLTKVIKELAGK--SIDDLIKEGREKLSSMPVGGG--GAVAAADAAPAAAAG-GDKKEAKK
MOS10080|Rplp2       --MRYVAAYLLAVLGGNAAPSNSDIEKILSSVGIEADSTRVTKVVNELKSK--SIEELIASGREKLSSMPAGGG---AAAAAPAAAGGGGG-AAPAAEKK
BEE10081|Rplp2       --MRYVAAYLLAVLGGKTSPNQNDIEKILSSVGIETDGEKLKKVIAELNGK--SIEELISQGMEKLLSMPVGGG--VAVSADAAPVGGTTAPAEEKKEEK
CEL10085|rla-2       --MRYVSAYLLAVLGGNANPKVDDLKNILSAVGVDADAETAKLVVSRLAGK--TVEELIAEGSAGLVSVSGG------AAPAAAAAPA-AGGAAPAADSK
BMA10079|RPLP2       --MRYVSAYMLAAMGAKHHVTANDIGNILGSVGVDCEHDKVEDVIKKMEGK--TLDELIREGSKYLASISAAPPCGTLTASAATSLAD-NKDAVTASSAK
STE10079|RPLP2       --MRYVAAYLLATLGNNKNPSAKDIKGILDSVGIESDMERLNKVISELSGK--SVDEIIQAGKSKLATVPTGGA--VAAGGAPAAAA--AGGDAKAEEKK
MBR10079|RPLP2       --MRYVAAYLLAALGGNAKPSAADLKKIFESVGVSVDDEQLNTVISQLADK--ELEELIAEGQEKLASVPSGGA--AAPAAAAAGGAG------EAKAEE
NEU10080|Rplp2       --MKHLAAYLLLTLGGNTAPSAADVKAVLESVGIEADSERLDKLISELEGK--DLNELIAEGSSKLASVPSGG----AAAPAAGG---AAAAAGGAAEEK
GRI10079|Rplp2       --MKHLAAYLLLGLAGNESPSASDIKTVLESVGIEADDERLEKLISELKGK--DIKELIAEGSAKLASVPSGG-----GGGGGAA---AAAGGAAPEAAK
GRA10080|Rplp2       --MKHLAAYLLLGLGGNTSPSAADVKAVLTSVGIDADEDRLNKLISELEGK--DIQQLIAEGSEKLASVPSGG-----AGGASGG---AAAAGGAAEEAK
STA10079|Rplp2       --MKHLAAYLLLGLGGNTSPSASDVKEVLESVGIEADSERLDKLISELEGK--DINELIAEGSSKLASVPSGGS--GGGAAAAGG---AAAAAGGDAAPA
YAR10082|RPLP2       --MKYLAAYLLLNAAGNTSPSAADIEKVISSVGIEVDSERVAALLKDLEGK--SVDELVAEGTEKLASVPSGGA--APAAAGGAA---AGSSDAPAAEEK
POM10139|RPLP2-1     --MKYLAAYLLLTVGGKDSPSASDIESVLSTVGIEAESERIETLINELNGK--DIDELIAAGNEKLATVPTGG----AASAAPAA---AAGGAAPAAEEA
POM10140|RPLP2-2     --MKYLAAYLLLTVGGKQSPSASDIESVLSTVGIEAEAERVESLISELNGK--NIEELIAAGNEKLSTVPSAG----AVATPAAG---GAAGAEATSAAE
POM10141|RPLP2-3     --MKYLAAYLLLTVGGKNSPSASDIESVLSTVGIESESERVEALIKELDGK--DIDELIAAGNEKLATVPSGG----AAAAAAPA---AAGGAAPAAEEA
YST10137|RPP2A       --MKYLAAYLLLNAAGNT-PDATKIKAILESVGIEIEDEKVSSVLSALEGK--SVDELITEGNEKLAAVP--AA--GPASAGGAA---AASGDAAAEEEK
CIN10080|RPLP2       --MRYIAAYLLLVTGGNASPSADDIKKLLGTVGIESDDERLEKLLSELQGK--DINELIAEGTSKLASVPSGGA--GGAAPAAAA---GGAGDAAAEEKK
NEA10079|Rplp2       --MKLIAAYLLLQQGGNASPSAADIKALLETVGVEAEEDRLSKLISELEGK--DINEVIAEGSSKLASVPSGG---AAPAAAAGG---AAAGGAAEAAPA
MAY10079|Rplp2       --MKHIAAYLLLTLGGKESPSAADIKALLETVGIEAESERLDKLIEELNGK--DINTLIAEGQEKLASVPAGG---AAPAAAAAG---GAAPAAAGAAKE
RHI10303|RPLP2       --MKYLAAYLLLNAGGKANPSADEVKSILSSVGAEIDEERVSSLISALAEK--DIAELIAEGKEKMASVPTGGA--VAAAGTGAA---AASSDAPAAETK
RHI10304|RPLP2-2     --MKYLASYLLLVAGGKTAPTAADVKGLMASVGVEAEEERLNSLISALEGK--NVEELIAEGKEKMASVPTGGA--VAAAGAGAA---AASTDAPAAEAK
RHI10305|RPLP2-3     --MKHLAAYLLLVAGGNATPSNEDIKKLLSSVGAEADAARLDSLLKALEGK--TVAEVIAEGSTKLASVSAGPV--AAAGAAGGG---AAVQDAPAAEEK
ARA10220|RPP2A       --MKVVAAFLLAVLSGKASPTTGDIKDILGSVGAETEDSQIELLLKEVKGK--DLAELIAAGREKLASVPSGGG--GGVAVASATSGGGGGGGAPAAESK
ARA10221|RPP2B       --MKVVAAYLLAVLSGKASPTSADIKTILGSVGAETEDSQIELLLKEVKGK--DLAELIAAGREKLASVPSGGG--GGVAVASATSGGGGGGGASAAESK
ARA10222|RPP2C       --MKVIAAFLLAKLGGNENPTSNDLKKILESVGAEIDETKIDLLFSLIKDH--DVTELIAAGREKMSALSSGGP--AVAMVAGGGGGGAASAAEPVAESK
ARA10223|RPP2D       --MKVAAAFLLAVLGGNANPSADNIKDIIGAVGADVDGESIELLLKEVSGK--DIAELIASGREKLASVPSGGG--VAVSAAPSS----GGGGAAAPAEK
ARA10224|RPP2E       --MKVVAAYLLAKLSGNENPSVADLKKIVESVGAEIDQEKIDLFFSLIKDR--DVTELIAVGREKMAALSSGGG--AVAVASGGGGG-AAPAAEPASVES
RIC10268|RPP2A       --MKLIAAYLLAVLGGNTSPSADDIKNILESVGVEANDERLEFLLSELEGK--DITEVIAAGREKFASVPSGGG--GGIAVAAPT-AAG-GGAAPAEEAK
RIC10269|RPP2B       --MKFISAYLMAYLAGNSSPTAEDLTTILESVGCEIDNAKMELLLSQVSGK--DITELIACGREKFASVPSGGG--GVAVAAAAP-AAGGAGGAPAAEAK
RIC10270|RPP2C       --MRFVSAYLMAYIGGNESPSKDDVRAILGSVGADVDEAKLDLLFEEIAGK--DIPELIAAGRERLALAAPCGG---VAAAAAGGQAVAAGGAAAAAEEE
RIC10271|RPP2D       --MKFISAYLLATLAGNPNPSAEDLTTILESVGAEVDHGKMELLLSQLAGK--DITEIIASGREKFASVPCGGG--GVAVAAAAP-AAG-GGAAPQSEAK
RIC10272|RPP2E       --MRFVAAYLMATIGGNASPTKDDVRAILGAVGADIDEDKLGYLFDQVAGK--DLAEILAAGSEMLAFG----------AAPAAAAATAGGAAAAGEKEE
RIC10273|RPP2E       --MRFVAAYLMATIGGNASPTKDDVRAILGAVGADVDEDKLGYLFDQVAGK--DLSEILAAGSEMLAFGGVG-------AAPAAAATAGGGAAAAGEKEK
GMA10401|LOC10081749 --MKVIAAYLLAVLGGNAAPSADDLRDILGSVGADANDDNISNFLSEVKGK--DIVELIASGREKLASVPSGGG--AAVAVAAAP-GGGP-AAPAAAESK
GMA10402|LOC10050033 --MKVVAAYLLAVLGGNNTPSADDIKEILGSVGIEADEDRIESFLSEVKGK--DIVELIAAGKEKLASVPSGGG--GAVAVAAAP-GGGGGGAAPAAEVK
GMA10403|LOC10049976 --MKVVAAYLLAVLGGNNSPSADVIKEILGSVGVEADEDRIESFLSEVKGK--DIVELIAAGREKLATVPSGGG--GAVAVAAAP-GGGAAAAAPAAEAK
GMA10404|LOC10078702 --MKVIAAYLLAVLGGNAAPSADDLRTILGSVGADANDDNISNFLSEVKGK--DIAELIAAGREKLASVPSGGG--AAVSVAAAP-GGGA-AAPAAAESK
GMA10405|LOC10079168 --MKVVAAYLLAVLGGNPSPSADDIKNILGAVGAEAEHELIELLLTEVKGK--DFNELLASGSEKISAVA-GGG--AAVAVAAAPAGGAGGGAAPAAEAK
GMA10406|LOC10030626 --MKVVAAYLLAVLGGNPSPSADDIKHILGAVGAEAENELIELLLTEVKGK--DFNELIASGSEKMSAVS-GGG--AAVAVAAAPAG---GAAAPAAEAK
POP10080|RPLP2       --MKVVAAYLLAVLGGNTCPTAEDLKNILGSVGADADDDRIELLLSSVKGK--DITELIASGREKLASVPSGGG--VAVSAGAAP-AAAG-GAAPAAEAK
CRE10079|RPLP2       --MRVVSAYLLAVLGGKANPTADDVNKILSSVGVEAEAEKVNKLISELEGK--NLAEVIAAGRSKLASVPSGGA--VAAAPS-GGAAPAAGGAAAPKKEE
VOL10084|RPLP2       --MRVVSAYLLAVLGGKASPTADDINKILSSVGVEADADKVNKLISELEGK--DLQEVLAAGRAKLASVPSGGA--VAAAAAPAAGGAAPAAAAAPKKEE
PTR10082|RPLP2-1     --MKHLAAYLLLQLGGNASPTKDDITQALSAVGVEVDGADLDRMLADLEGQ--DLEALLESGN--ALLATFGGG-------GGGGGAAAAGG--EAAVEE
PTR10083|RPLP2-2     --MIEIAALLLCKLGGQGG-SSDEVKAVIEAAGLEANEEQLAKLIGDMEGK--DVNELMAAGSEKIKDVPFGGG-------GGGGGGAGDGGGAGAIEEA
TPS10080|Rplp2       --MKHMAAYLMLVLGGNESPSAADVTAALSSVGIEADADALNNLISELEGK--DLEEVLASGNELLAKFGSGGG-------GGGGGGGGGGGEGGEQAAA
CYA10080|RPP2        --MKYLAAYMLLKLGGAEEVTADDIRKVVSAAGAEVDDDRVAALLQAVNGR--SIDELVTEGRSKMESVAGVAVAAASAAPAAAAAGGGDSGAAAASADK
DIC10079|RPLP2       --MKYLAAYLLASLSG--NANAASVTKILQSVGVEVDAARVESVCKELDGK--DVQALIAAGKSKVGSVA---------AAAAPAAATSAAPAAAAAAPA
PLA10083|RPLP2       MAMKYVAAYLMCVLGGNENPSTKEVKNVLGAVNADVEDEVLNNFIDSLKGK--SCHELITDGLKKLQNIG-------GGVAAAPAGAAAVETAEAKKEDK
TGO10079|RPLP2       --MKYVAAYLMVVLSGTDAPTKKQVEKTLSSVGIDVEDDIMDAFFKAVEGK--TPHELIAAGMEKLQKVPS------GGVAAAAAPAAGAADAGAGAAAK
GIA10079|Rplp2       --MKHLAAYLLAKMGGKNEPAVADIEKIIAAVGGTTDADLAKTVVEKVGAGGLSVEDLMSLGKKRMASMPAVGA-----APAAASTAAAVAEAAPAAAKK


HUM10080|RPLP2       KDEKKEESEESDDDMGFGLFD----------
DOG10079|Rplp2       KDEKKEESEESDDDMGFGLFD----------
MUS10079|Rplp2       KDEKKEESEESDDDMGFGLFD----------
RAT10079|LOC368019   KDEKKEESEESDDDMGFGLFD----------
CHK10081|Rplp2       KEEKKEESEESDDDMGFGLFD----------
FUG10080|RPLP2       KEEKKEESEESDEDMGFGLFD----------
DAN10079|Rplp2       KEEKKEESEESDDDMGFGLFD----------
MED10079|Rplp2       KEEKKEESEESDEDMGFGLFD----------
CIO10079|RPLP2       EAKKEESEEESDDDMGFGLFD----------
DRO10098|RpLP2       EEKK-EESESEDDDMGFALFE----------
MOS10080|Rplp2       EEKK-EESESEDDDMGFGLFE----------
BEE10081|Rplp2       KPAK-EESESEDDDMGFGLFD----------
CEL10085|rla-2       PAKKEEPKEESDDDMGFGLFD----------
BMA10079|RPLP2       KEEKKEKEEESDEDMGFGLFD----------
STE10079|RPLP2       EEKKAESEEESDDDMGFGLFD----------
MBR10079|RPLP2       KAPEPEESEDEDMDG-FSLFD----------
NEU10080|Rplp2       KEEKVEEKEESDEDMGFGLFD----------
GRI10079|Rplp2       EEEKEEEKEESDEDMGFGLFD----------
GRA10080|Rplp2       EEEKEEEKEESDEDMGFGLFD----------
STA10079|Rplp2       EEAKEEEKEESDDDMGFGLFD----------
YAR10082|RPLP2       EEEKEE----SDDDMGFGLFD----------
POM10139|RPLP2-1     AKEEAKEEEESDEDMGFGLFD----------
POM10140|RPLP2-2     EAKEEEAAEESDEDMGFGLFD----------
POM10141|RPLP2-3     AKEEAKEEEESDEDMGFGLFD----------
YST10137|RPP2A       EEEAAEE---SDDDMGFGLFD----------
CIN10080|RPLP2       EEKKEEEKEESDDDMGFGLFD----------
NEA10079|Rplp2       EEKKEEAKEESDDDMGFGLFD----------
MAY10079|Rplp2       EEKKEEEKEESDDDMGFGLFD----------
RHI10303|RPLP2       EEEKEE----SDDDMGFGLFD----------
RHI10304|RPLP2-2     EEEKEE----SDDDMGFGLFD----------
RHI10305|RPLP2-3     AEEKEE----SDDDMGFGLFD----------
ARA10220|RPP2A       KEEKKEEKEESDDDMGFSLFE----------
ARA10221|RPP2B       KEEKKEEKEESDDDMGFSLFE----------
ARA10222|RPP2C       KKVEEVKDESSDDAGMMGLFD----------
ARA10223|RPP2D       KEAKKEEKEESDDDMGFSLFE----------
ARA10224|RPP2E       KKKEEEKEESEDDGGMMSLFD----------
RIC10268|RPP2A       KEEKVEEKEESDDDMGFSLFD----------
RIC10269|RPP2B       KEDKVEEKEESDDDMGFSLFD----------
RIC10270|RPP2C       AEEEEKKKEEEDDDGLFNLFD----------
RIC10271|RPP2D       KEEKVEEKEESDDDMGFSLFD----------
RIC10272|RPP2E       EEKVEEKEKEGEDDIVFSLFDDE--------
RIC10273|RPP2E       EE--EKVEEEEEDDIVFSLFDDE--------
GMA10401|LOC10081749 KEEKVEEKEESDDDMGFSLFD----------
GMA10402|LOC10050033 KEEKVEEKEESDDDMGFSLFD----------
GMA10403|LOC10049976 KEEKVEEKEESDDDMGFSLFD----------
GMA10404|LOC10078702 KEEKVEEKEESDDDMGFSLFD----------
GMA10405|LOC10079168 EEKKVEEKEESDDDMGFSLFD----------
GMA10406|LOC10030626 EEKKVEEKEESDDDMGFSLFD----------
POP10080|RPLP2       KEEKVEEKEESDDDMGFSLFD----------
CRE10079|RPLP2       KKEPSEEEDMGFSLFD---------------
VOL10084|RPLP2       KKEPSEEEVSVVSRRCMQWMV----------
PTR10082|RPLP2-1     KVEEKEEEEEMDLGGGMDMFGAEEGGGGDY-
PTR10083|RPLP2-2     KPEEKEEEEEMDLGGGMDMFGGDEGGGGGDY
TPS10080|Rplp2       KEEEVVEEEAPPAT---DMFGGGDGGDY---
CYA10080|RPP2        GAAKEEPKEESDEDLGFGLFD----------
DIC10079|RPLP2       KKVVEEKKEESDDDMGMGLFD----------
PLA10083|RPLP2       KEEKKEEEEEEEDDLGFSLFG----------
TGO10079|RPLP2       KEEEKKEEEEEEDDMGFSLFD----------
GIA10079|Rplp2       EESDDDEIVGAGGMFGGDSSSSEEESSSD--