CLUSTAL W (2.1) Multiple Sequence Alignments
HAL10008|VNG2648G    -----MQQARVRLAGVDPDDLDNICGEVQEIADKTGVKVSGPVPLPTKTLEVPSRKSPDGEGTATWEHWEMRVHKRLIDIDA-DERALRQLMRIQVPNDV
MET10012|MJ0322      LRGESMQRARIKLSSTDHKVLDEICRQIKEIAEKTGVDISGPIPLPTKVLRVVTRKSPDGEGSSTFDRWTMKIHKRLIDIDA-DERALRHIMKIRIPDNV
PYR10008|PH1483      -----MQKARIKLASTNVRSLEEVANQIRQIAERTGVRMSGPIPLPTKRIRIVTRKSPDGEGSATFDRWELRIHKRLIDIEA-DERAMRQIMRIRVPEDV
THE10010|TTHA1693    -----MPKIRIKLRGFDHKTLDASAQKIVEAARRSGAQVSGPIPLPTRVRRFTVIRGPFKH-KDSREHFELRTHNRLVDIINPNRKTIEQLMTLDLPTGV
SYN10011|sll1101     MATLQQQKIRIRLKAFDRRLLDTSCDKIVDTANRTNAAAVGPIPLPTKRKIYCVLRSPHVD-KDSREHFETRTHRRIIDIYQPSSKTIDALMKLDLPAGV
BAC10010|Bsu0115     ---MAKQKIRIRLKAYDHRILDQSAEKIVETAKRSGASVSGPIPLPTEKSVYTILRAVHKY-KDSREQFEMRTHKRLIDIVNPTPQTVDALMRLDLPSGV
ECO10010|rpsJ        ---MQNQRIRIRLKAFDHRLIDQATAEIVETAKRTGAQVRGPIPLPTRKERFTVLISPHVN-KDARDQYEIRTHLRLVDIVEPTEKTVDALMRLDLAAGV
SUL10008|ST0268      ----MPTKARIRLWSTNIENLNFVVNQIKTLAQKTGVEISGPIPLPTSRMEVPVMRLPHGEGKKKWEHWEMKIHKRIIDIAS-DERVMRQLMRVRVPDDV


HAL10008|VNG2648G    NIEIVLED---
MET10012|MJ0322      QIEIQFK----
PYR10008|PH1483      TIEIELIS---
THE10010|TTHA1693    EIEIKTVGGGR
SYN10011|sll1101     DIEVKL-----
BAC10010|Bsu0115     DIEIKL-----
ECO10010|rpsJ        DVQISLG----
SUL10008|ST0268      YIEIELI----