CLUSTAL W (2.1) Multiple Sequence Alignments
HAL10009|VNG1134G    ---------------------------------MTVTDQTGAETLAKSSGGSVVKQNRDEASPYAAMQMAEQLAEEVLDQGIEKVHVRVRGPGGNLQRSP
MET10013|MJ0191      -----------MAEQKKEKWGIVHIYSSYNNTIIHATDITGAETIARVSGGRVTRNQRDEGSPYAAMQAAFKLAEVLKERGIENIHIKVRAPGGSGQKNP
PYR10009|PH1638      ------MSEEQVNIKKKEKWGIAHIYSSYNNTIIHITDITGAETISRWSGGMVVKADRDEPSPYAAMLAARRAAEEALEKGIVGVHIRVRAPGGSKSKTP
THE10011|TTHA1666    ----MAKKPSKKKVKRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSR-KGTPYAAQLAALDAAKKAMAYGMQSVDVIVRG--------T
SYN10012|sll1817     -MARPTRKTGPKKAKKNVPSGVAHIQSTFNNTIVTISDIRGDVISWASAGSSGFKGAK-KGTPYAAQTAADSAARRAMEQGMRQLEVMVSG--------P
BAC10011|Bsu0142     MAAARKSNTRKRRVKKNIESGIAHIRSTFNNTIVTITDTHGNAISWSSAGALGFRGSR-KSTPFAAQMAAETAAKGSIEHGLKTLEVTVKG--------P
ECO10011|rpsK        --MAKAPIRARKRVRKQVSDGVAHIHASFNNTIVTITDRQGNALGWATAGGSGFRGSR-KSTPFAAQVAAERCADAVKEYGIKNLEVMVKG--------P
SUL10009|ST2068      --------VKKMSSRREIRWGIARVYASQNNTLITITDITGAEIISRASGGMVVKADREKPSPYAAMLAANKAATEAFDKGISAIHIKVRAQGGYGSKTP


HAL10009|VNG1134G    GPGAQAAIRALARAGLEIGRIEDVTPIPHDGTRPPKNSGY---
MET10013|MJ0191      GPGAQAAIRALARAGLRIGRIEDVTPVPHDGTTPKKRFKK---
PYR10009|PH1638      GPGAQAAIRALARAGLKIGRVEDVTPIPHDGTRPKGGRRGRRV
THE10011|TTHA1666    GAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS-
SYN10012|sll1817     GAGRETAIRALQGAGLEITLIRDVTPIPHNGCRPPKRRRV---
BAC10011|Bsu0142     GSGREAAIRALQAAGLEVTAIRDVTPVPHNGCRPPKRRRV---
ECO10011|rpsK        GPGRESTIRALNAAGFRITNITDVTPIPHNGCRPPKKRRV---
SUL10009|ST2068      GPGAQPAIRALARAGFIIGRIEDVTPIPHDSIRRPGGRRGRRV